WB (Western Blot)
(WB Suggested Anti-SERPINB2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Human Liver)
Rabbit SERPINB2 Polyclonal Antibody | anti-SERPINB2 antibody
SERPINB2 antibody - middle region
Gene Names
SERPINB2; PAI; PAI2; PAI-2; PLANH2; HsT1201
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep
Applications
Western Blot
Purity
Affinity Purified
Synonyms
SERPINB2, Antibody; SERPINB2 antibody - middle region; anti-SERPINB2 antibody
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: GKIPNLLPEGSVDGDTRMVLVNAVYFKGKWKTPFEKKLNGLYPFRVNSAQ
Sequence Length
415
Applicable Applications for anti-SERPINB2 antibody
WB (Western Blot)
Homology
Cow: 86%; Dog: 100%; Guinea Pig: 92%; Horse: 93%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 85%; Sheep: 86%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human SERPINB2
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
WB (Western Blot)
(WB Suggested Anti-SERPINB2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Human Liver)
WB (Western Blot)
(WB Suggested Anti-SERPINB2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Human Liver)
WB (Western Blot)
(Host: RabbitTarget Name: CHADSample Type: Human Adult PlacentaAntibody Dilution: 1.0ug/ml)
WB (Western Blot)
(Host: RabbitTarget Name: CHADSample Type: Human Adult PlacentaAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-SERPINB2 antibody
This is a rabbit polyclonal antibody against SERPINB2. It was validated on Western Blot using a cell lysate as a positive control.
Target Description: SERPINB2 inhibits urokinase-type plasminogen activator. The monocyte derived PAI-2 is distinct from the endothelial cell-derived PAI-1.
Target Description: SERPINB2 inhibits urokinase-type plasminogen activator. The monocyte derived PAI-2 is distinct from the endothelial cell-derived PAI-1.
Product Categories/Family for anti-SERPINB2 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
44kDa
NCBI Official Full Name
plasminogen activator inhibitor 2
NCBI Official Synonym Full Names
serpin family B member 2
NCBI Official Symbol
SERPINB2
NCBI Official Synonym Symbols
PAI; PAI2; PAI-2; PLANH2; HsT1201
NCBI Protein Information
plasminogen activator inhibitor 2
UniProt Protein Name
Plasminogen activator inhibitor 2
UniProt Gene Name
SERPINB2
UniProt Synonym Gene Names
PAI2; PLANH2; PAI-2
UniProt Entry Name
PAI2_HUMAN
Similar Products
Product Notes
The SERPINB2 serpinb2 (Catalog #AAA200583) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The SERPINB2 antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep and may cross-react with other species as described in the data sheet. AAA Biotech's SERPINB2 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the SERPINB2 serpinb2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: GKIPNLLPEG SVDGDTRMVL VNAVYFKGKW KTPFEKKLNG LYPFRVNSAQ. It is sometimes possible for the material contained within the vial of "SERPINB2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.