Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA199820_WB13.jpg WB (Western Blot) (Human HepG2 cellsSETD2 is strongly supported by BioGPS gene expression data to be expressed in Human HepG2 cells)

Rabbit SETD2 Polyclonal Antibody | anti-SETD2 antibody

SETD2 antibody - N-terminal region

Gene Names
SETD2; LLS; HYPB; SET2; HIF-1; HIP-1; KMT3A; HBP231; HSPC069; p231HBP
Reactivity
Cow, Dog, Horse, Human, Rat
Applications
Western Blot, Immunohistochemistry
Purity
Protein A purified
Synonyms
SETD2, Antibody; SETD2 antibody - N-terminal region; anti-SETD2 antibody
Ordering
Host
Rabbit
Reactivity
Cow, Dog, Horse, Human, Rat
Clonality
Polyclonal
Purity/Purification
Protein A purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: SDEDSVRTSSSQRSHDLKFSASIEKERDFKKSSAPLKSEDLGKPSRSKTD
Sequence Length
891
Applicable Applications for anti-SETD2 antibody
WB (Western Blot), IHC (Immunohistochemistry)
Homology
Cow: 79%; Dog: 86%; Horse: 86%; Human: 100%; Rat: 85%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human SETD2
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(Human HepG2 cellsSETD2 is strongly supported by BioGPS gene expression data to be expressed in Human HepG2 cells)

product-image-AAA199820_WB13.jpg WB (Western Blot) (Human HepG2 cellsSETD2 is strongly supported by BioGPS gene expression data to be expressed in Human HepG2 cells)

IHC (Immunohistochemistry)

(SETD2 antibody - N-terminal region validated by IHC using Human Placenta lysate at 4.0-8.0.)

product-image-AAA199820_IHC15.jpg IHC (Immunohistochemistry) (SETD2 antibody - N-terminal region validated by IHC using Human Placenta lysate at 4.0-8.0.)
Related Product Information for anti-SETD2 antibody
This is a rabbit polyclonal antibody against SETD2. It was validated on Western Blot and immunohistochemistry

Target Description: Huntington's disease (HD), a neurodegenerative disorder characterized by loss of striatal neurons, is caused by an expansion of a polyglutamine tract in the HD protein huntingtin. SETD2 is a protein belonging to a class of huntingtin interacting proteins characterized by WW motifs.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
97kDa
NCBI Official Full Name
SETD2 protein, partial
NCBI Official Synonym Full Names
SET domain containing 2, histone lysine methyltransferase
NCBI Official Symbol
SETD2
NCBI Official Synonym Symbols
LLS; HYPB; SET2; HIF-1; HIP-1; KMT3A; HBP231; HSPC069; p231HBP
NCBI Protein Information
histone-lysine N-methyltransferase SETD2
UniProt Protein Name
Histone-lysine N-methyltransferase SETD2
UniProt Gene Name
SETD2
UniProt Synonym Gene Names
HIF1; HYPB; KIAA1732; KMT3A; SET2; HIP-1; hSET2
UniProt Entry Name
SETD2_HUMAN

Similar Products

Product Notes

The SETD2 setd2 (Catalog #AAA199820) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The SETD2 antibody - N-terminal region reacts with Cow, Dog, Horse, Human, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's SETD2 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot), IHC (Immunohistochemistry). Researchers should empirically determine the suitability of the SETD2 setd2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: SDEDSVRTSS SQRSHDLKFS ASIEKERDFK KSSAPLKSED LGKPSRSKTD. It is sometimes possible for the material contained within the vial of "SETD2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.