Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA198693_WB11.jpg WB (Western Blot) (WB Suggested Anti-SFRS10 Antibody Titration: 5.0ug/mlELISA Titer: 1:62500Positive Control: 293T cell lysateThere is BioGPS gene expression data showing that TRA2B is expressed in HEK293T)

Rabbit SFRS10 Polyclonal Antibody | anti-TRA2B antibody

SFRS10 antibody - middle region

Average rating 0.0
No ratings yet
Gene Names
TRA2B; SFRS10; SRFS10; TRAN2B; PPP1R156; TRA2-BETA; Htra2-beta
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Western Blot, Immunohistochemistry
Purity
Protein A purified
Synonyms
SFRS10, Antibody; SFRS10 antibody - middle region; anti-TRA2B antibody
Ordering
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Protein A purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: GVFGLSLYTTERDLREVFSKYGPIADVSIVYDQQSRRSRGFAFVYFENVD
Sequence Length
288
Applicable Applications for anti-TRA2B antibody
WB (Western Blot), IHC (Immunohistochemistry)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 92%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human SFRS10
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-SFRS10 Antibody Titration: 5.0ug/mlELISA Titer: 1:62500Positive Control: 293T cell lysateThere is BioGPS gene expression data showing that TRA2B is expressed in HEK293T)

product-image-AAA198693_WB11.jpg WB (Western Blot) (WB Suggested Anti-SFRS10 Antibody Titration: 5.0ug/mlELISA Titer: 1:62500Positive Control: 293T cell lysateThere is BioGPS gene expression data showing that TRA2B is expressed in HEK293T)

IHC (Immunohiostchemistry)

(Rabbit Anti-TRA2B AntibodyParaffin Embedded Tissue: Human alveolar cellCellular Data: Epithelial cells of renal tubuleAntibody Concentration: 4.0-8.0 ug/mlMagnification: 400X)

product-image-AAA198693_IHC13.jpg IHC (Immunohiostchemistry) (Rabbit Anti-TRA2B AntibodyParaffin Embedded Tissue: Human alveolar cellCellular Data: Epithelial cells of renal tubuleAntibody Concentration: 4.0-8.0 ug/mlMagnification: 400X)

IHC (Immunohistochemistry)

(Rabbit Anti-SFRS10 AntibodyParaffin Embedded Tissue: Human MuscleCellular Data: Skeletal muscle cellsAntibody Concentration: 4.0-8.0 ug/mlMagnification: 400X)

product-image-AAA198693_IHC15.jpg IHC (Immunohistochemistry) (Rabbit Anti-SFRS10 AntibodyParaffin Embedded Tissue: Human MuscleCellular Data: Skeletal muscle cellsAntibody Concentration: 4.0-8.0 ug/mlMagnification: 400X)
Related Product Information for anti-TRA2B antibody
This is a rabbit polyclonal antibody against SFRS10. It was validated on Western Blot and immunohistochemistry

Target Description: SFRS10 contains 1 RRM (RNA recognition motif) domain and belongs to the splicing factor SR family. It is a sequence-specific RNA-binding protein which participates in the control of pre-mRNA splicing.
Product Categories/Family for anti-TRA2B antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
32kDa
NCBI Official Full Name
transformer-2 protein homolog beta isoform 2
NCBI Official Synonym Full Names
transformer 2 beta homolog
NCBI Official Symbol
TRA2B
NCBI Official Synonym Symbols
SFRS10; SRFS10; TRAN2B; PPP1R156; TRA2-BETA; Htra2-beta
NCBI Protein Information
transformer-2 protein homolog beta
UniProt Protein Name
Transformer-2 protein homolog beta
UniProt Gene Name
TRA2B
UniProt Synonym Gene Names
SFRS10; TRA-2 beta; TRA2-beta; hTRA2-beta
UniProt Entry Name
TRA2B_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The TRA2B tra2b (Catalog #AAA198693) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The SFRS10 antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's SFRS10 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot), IHC (Immunohistochemistry). Researchers should empirically determine the suitability of the TRA2B tra2b for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: GVFGLSLYTT ERDLREVFSK YGPIADVSIV YDQQSRRSRG FAFVYFENVD. It is sometimes possible for the material contained within the vial of "SFRS10, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.