Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA201256_WB11.jpg WB (Western Blot) (WB Suggested Anti-SFTPA2 AntibodyTitration: 1.0 ug/mlPositive Control: Fetal Heart)

Rabbit SFTPA2 Polyclonal Antibody | anti-SFTPA2 antibody

SFTPA2 antibody - N-terminal region

Average rating 0.0
No ratings yet
Gene Names
SFTPA2; PSAP; PSPA; SP-A; SPA2; PSP-A; SFTP1; SP-2A; SPAII; COLEC5; SFTPA2B
Reactivity
Tested Species Reactivity: Human
Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Goat, Guinea Pig, Horse, Pig, Rabbit, Sheep, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
SFTPA2, Antibody; SFTPA2 antibody - N-terminal region; anti-SFTPA2 antibody
Ordering
Host
Rabbit
Reactivity
Tested Species Reactivity: Human
Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Goat, Guinea Pig, Horse, Pig, Rabbit, Sheep, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration
0.5 mg/ml (varies by lot)
Sequence
Synthetic peptide located within the following region: PGNNGLPGAPGVPGERGEKGEAGERGPPGLPAHLDEELQATLHDFRHQIL
Sequence Length
248
Applicable Applications for anti-SFTPA2 antibody
WB (Western Blot)
Protein Size (# AA)
248 amino acids
Homology
Cow: 100%; Dog: 92%; Goat: 91%; Guinea Pig: 86%; Horse: 86%; Human: 100%; Mouse: 86%; Pig: 93%; Rabbit: 86%; Rat: 86%; Sheep: 93%; Zebrafish: 85%!@
Protein Interactions
SFTPA2; SFTPA1; CD93;
Blocking Peptide
For anti-SFTPA2 (MBS3216264) antibody is Catalog #
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-SFTPA2 AntibodyTitration: 1.0 ug/mlPositive Control: Fetal Heart)

product-image-AAA201256_WB11.jpg WB (Western Blot) (WB Suggested Anti-SFTPA2 AntibodyTitration: 1.0 ug/mlPositive Control: Fetal Heart)

WB (Western Blot)

(Lanes:Lane 1: 25ng purified Human Alveolar sample (w/SP-A1+SP-A2)Lane 1: 25ng purified Human Alveolar sample (w/SP-A1+SP-A2)Lane 2: 20ug Rat bronchoalveolar lavageLane 3: 25ng hSP-A2 variant expressed in CHO cellsLane 4: 25ng hSP-A2 variant expressed in CHO cellsLane 5: 25ng hSP-A1/A2 variants expressed in CHO cellsLane 6: 25ng hSP-A1/A2 variants expressed in CHO cellsLane 7: 20ug SP-A1/2 KO mouse bronchoalveolar lavageLane 8: 20ug hSP-A2 variant transgenic mouse bronchoalveolar lavageLane 9: 20ug hSP-A2 variant transgenic mouse bronchoalveolar lavageLane 10: 20ug hSP-A1 variant transgenic mouse bronchoalveolar lavageLane 11: 20ug hSP-A1 variant transgenic mouse bronchoalveolar lavageLane 12: 20ug hSP-A1/A2 variants transgenic mouse bronchoalveolar lavageLane 13: 20ug mSP-A1/A2 bronchoalveolar lavage; +/- mouseLane 14: 20ug mSP-A1/A2 bronchoalveolar lavage; WT mouseLane 15: 10ug human alveolar cell lysateLane 16: 25ng purified hSP-A1/A2Primary Antibody Dilution:1:2500Secondary Antibody:IgG HRP ConjSecondary Antibody Dilution:1:10000Gene Name:SFTPA2Submitted by:Todd M. Umstead, Pennsylvania State University College of Medicine)

product-image-AAA201256_WB13.jpg WB (Western Blot) (Lanes:Lane 1: 25ng purified Human Alveolar sample (w/SP-A1+SP-A2)Lane 1: 25ng purified Human Alveolar sample (w/SP-A1+SP-A2)Lane 2: 20ug Rat bronchoalveolar lavageLane 3: 25ng hSP-A2 variant expressed in CHO cellsLane 4: 25ng hSP-A2 variant expressed in CHO cellsLane 5: 25ng hSP-A1/A2 variants expressed in CHO cellsLane 6: 25ng hSP-A1/A2 variants expressed in CHO cellsLane 7: 20ug SP-A1/2 KO mouse bronchoalveolar lavageLane 8: 20ug hSP-A2 variant transgenic mouse bronchoalveolar lavageLane 9: 20ug hSP-A2 variant transgenic mouse bronchoalveolar lavageLane 10: 20ug hSP-A1 variant transgenic mouse bronchoalveolar lavageLane 11: 20ug hSP-A1 variant transgenic mouse bronchoalveolar lavageLane 12: 20ug hSP-A1/A2 variants transgenic mouse bronchoalveolar lavageLane 13: 20ug mSP-A1/A2 bronchoalveolar lavage; +/- mouseLane 14: 20ug mSP-A1/A2 bronchoalveolar lavage; WT mouseLane 15: 10ug human alveolar cell lysateLane 16: 25ng purified hSP-A1/A2Primary Antibody Dilution:1:2500Secondary Antibody:IgG HRP ConjSecondary Antibody Dilution:1:10000Gene Name:SFTPA2Submitted by:Todd M. Umstead, Pennsylvania State University College of Medicine)

WB (Western Blot)

(Lanes:1: 20ng human SP-A2 protein,2: 20ug rat wt BAL cell lysate,3: 25ng hSP-A2 (1A0) protein purified from transfected CHO lysate,4: 25ng hSP-A2 (1A1) protein purified from transfected CHO lysate,5: 25ng hSP-A1 (6A2) protein purified from transfected CHO lysate,6: 25ng hSP-A1 (6A4) protein purified from transfected CHO lysate,7: 25ng hSP-A2/1 (1A0/6A4) protein purified from transfected CHO lysate,8: 25ng hSP-A2/1 (1A1/6A2) protein purified from transfected CHO lysate,9: 20ug SP-A KO mouse BAL lysate,10: 25ng hSP-A2 (1A0) protein purified from transfected mouse BAL lysate,11: 25ng hSP-A2 (1A1) protein purified from transfected mouse BAL lysate,12: 25ng hSP-A1 (6A2) protein purified from transfected mouse BAL lysate,13: 25ng hSP-A1 (6A4) protein purified from transfected mouse BAL lysate,14: 25ng hSP-A2/1 (1A0/6A2) protein purified from transfected mouse BAL lysate,15: 25ng mouse SP-A2 protein purified from mouse BAL lysate,16: 20ug mouse wt BAL lysate,17: 15ug human wt T2 lysate,18: 25ng human SP-A2 protein.)

product-image-AAA201256_WB15.jpg WB (Western Blot) (Lanes:1: 20ng human SP-A2 protein,2: 20ug rat wt BAL cell lysate,3: 25ng hSP-A2 (1A0) protein purified from transfected CHO lysate,4: 25ng hSP-A2 (1A1) protein purified from transfected CHO lysate,5: 25ng hSP-A1 (6A2) protein purified from transfected CHO lysate,6: 25ng hSP-A1 (6A4) protein purified from transfected CHO lysate,7: 25ng hSP-A2/1 (1A0/6A4) protein purified from transfected CHO lysate,8: 25ng hSP-A2/1 (1A1/6A2) protein purified from transfected CHO lysate,9: 20ug SP-A KO mouse BAL lysate,10: 25ng hSP-A2 (1A0) protein purified from transfected mouse BAL lysate,11: 25ng hSP-A2 (1A1) protein purified from transfected mouse BAL lysate,12: 25ng hSP-A1 (6A2) protein purified from transfected mouse BAL lysate,13: 25ng hSP-A1 (6A4) protein purified from transfected mouse BAL lysate,14: 25ng hSP-A2/1 (1A0/6A2) protein purified from transfected mouse BAL lysate,15: 25ng mouse SP-A2 protein purified from mouse BAL lysate,16: 20ug mouse wt BAL lysate,17: 15ug human wt T2 lysate,18: 25ng human SP-A2 protein.)
Related Product Information for anti-SFTPA2 antibody
This is a rabbit polyclonal antibody against SFTPA2. It was validated on Western Blot

Target Description: This gene is one of several genes encoding pulmonary-surfactant associated proteins (SFTPA) located on chromosome 10. Mutations in this gene and a highly similar gene located nearby, which affect the highly conserved carbohydrate recognition domain, are associated with idiopathic pulmonary fibrosis. The current version of the assembly displays only a single centromeric SFTPA gene pair rather than the two gene pairs shown in the previous assembly which were thought to have resulted from a duplication.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
26kDa
NCBI Official Full Name
pulmonary surfactant-associated protein A2 isoform 1
NCBI Official Synonym Full Names
surfactant protein A2
NCBI Official Symbol
SFTPA2
NCBI Official Synonym Symbols
PSAP; PSPA; SP-A; SPA2; PSP-A; SFTP1; SP-2A; SPAII; COLEC5; SFTPA2B
NCBI Protein Information
pulmonary surfactant-associated protein A2
UniProt Protein Name
Pulmonary surfactant-associated protein A2
UniProt Gene Name
SFTPA2
UniProt Synonym Gene Names
COLEC5; PSAP; SFTP1; SFTPA; SFTPA2B; PSP-A; PSPA; SP-A; SP-A2
UniProt Entry Name
SFPA2_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The SFTPA2 sftpa2 (Catalog #AAA201256) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The SFTPA2 antibody - N-terminal region reacts with Tested Species Reactivity: Human Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Goat, Guinea Pig, Horse, Pig, Rabbit, Sheep, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's SFTPA2 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the SFTPA2 sftpa2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: PGNNGLPGAP GVPGERGEKG EAGERGPPGL PAHLDEELQA TLHDFRHQIL. It is sometimes possible for the material contained within the vial of "SFTPA2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.