Rabbit anti-Horse, Human SH3BGR Polyclonal Antibody | anti-SH3BGR antibody
SH3BGR antibody - N-terminal region
Gene Names
SH3BGR; 21-GARP
Reactivity
Horse, Human
Applications
Western Blot
Purity
Affinity Purified
Synonyms
SH3BGR, Antibody; SH3BGR antibody - N-terminal region; anti-SH3BGR antibody
Host
Rabbit
Reactivity
Horse, Human
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: CGDFDSFFSAKEENIIYSFLGLAPPPDSKGSEKAEEGGETEAQKEGSEDV
Sequence Length
239
Applicable Applications for anti-SH3BGR antibody
WB (Western Blot)
Homology
Horse: 83%; Human: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human SH3BGR
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Related Product Information for anti-SH3BGR antibody
This is a rabbit polyclonal antibody against SH3BGR. It was validated on Western Blot using a cell lysate as a positive control.
Target Description: SH3BGR gene maps to the DS-CHD region and is a potential candidate for the pathogenesis of CHD.
Target Description: SH3BGR gene maps to the DS-CHD region and is a potential candidate for the pathogenesis of CHD.
Product Categories/Family for anti-SH3BGR antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
26kDa
NCBI Official Full Name
SH3 domain-binding glutamic acid-rich protein isoform a
NCBI Official Synonym Full Names
SH3 domain binding glutamate rich protein
NCBI Official Symbol
SH3BGR
NCBI Official Synonym Symbols
21-GARP
NCBI Protein Information
SH3 domain-binding glutamic acid-rich protein
UniProt Protein Name
SH3 domain-binding glutamic acid-rich protein
UniProt Gene Name
SH3BGR
UniProt Synonym Gene Names
SH3BGR protein; 21-GARP
UniProt Entry Name
SH3BG_HUMAN
Similar Products
Product Notes
The SH3BGR sh3bgr (Catalog #AAA199617) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The SH3BGR antibody - N-terminal region reacts with Horse, Human and may cross-react with other species as described in the data sheet. AAA Biotech's SH3BGR can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the SH3BGR sh3bgr for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: CGDFDSFFSA KEENIIYSFL GLAPPPDSKG SEKAEEGGET EAQKEGSEDV. It is sometimes possible for the material contained within the vial of "SH3BGR, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
