Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online
product-image-AAA21303_IHC10.jpg IHC (Immunohistochemistry) (SHMT/SHMT2 Antibody-Immunohistochemistry of paraffin-embedded rat spleen using SHMT2 antibody at dilution of 1:200 (200x lens).)

Rabbit SHMT/SHMT2 Polyclonal Antibody | anti-SHMT2 antibody

SHMT/SHMT2 Rabbit anti-Human Polyclonal Antibody

Reactivity
Mouse, Rat, Human
Applications
Immunofluorescence, Immunohistochemistry, Immunohistochemistry, Western Blot
Purity
Affinity purified
Synonyms
SHMT/SHMT2, Antibody; SHMT/SHMT2 Rabbit anti-Human Polyclonal Antibody; IHC-plus SHMT/SHMT2 Antibody; SHMT2; GLY A+; GLYA; Hydroxymethyltransferase 2; Serine methylase; Serine aldolase; SHMT; Threonine aldolase; Serine hydroxymethylase; anti-SHMT2 antibody
Ordering
Host
Rabbit
Reactivity
Mouse, Rat, Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Human SHMT/SHMT2
Purity/Purification
Affinity purified
Form/Format
PBS, pH7.3, 0.02% Sodium Azide, 50% Glycerol
Applicable Applications for anti-SHMT2 antibody
Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry-Paraffin (IHC-P), Western Blot (WB)
Application Notes
IF: 1:50-1:200
IHC: 1:50-1:200
IHC-P: 1:200
WB: 1:500-1:2000
The predicted MW is 53kDa/54kDa/55kDa, while the observed MW by Western blot was 52kDa.
Target
Human SHMT/SHMT2
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 265-504 of human SHMT2 (NP_005403.2). PSPFKHADIVTTTTHKTLRGARSGLIFYRKGVKAVDPKTGREIPYTFEDRINFAVFPSLQGGPHNHAIAAVAVALKQACTPMFREYSLQVLKNARAMADALLERGYSLVSGGTDNHLVLVDLRPKGLDGARAERVLELVSITANKNTCPGDRSAITPGGLRLGAPALTSRQFREDDFRRVVDFIDEGVNIGLEVKSKTAKLQDFKSFLLKDSETSQRLANLRQRVEQFARAFPMPGFDEH
Conjugation
Unconjugated
Preparation and Storage
Store at -20 degree C. Avoid freeze-thaw cycles.

IHC (Immunohistochemistry)

(SHMT/SHMT2 Antibody-Immunohistochemistry of paraffin-embedded rat spleen using SHMT2 antibody at dilution of 1:200 (200x lens).)

product-image-AAA21303_IHC10.jpg IHC (Immunohistochemistry) (SHMT/SHMT2 Antibody-Immunohistochemistry of paraffin-embedded rat spleen using SHMT2 antibody at dilution of 1:200 (200x lens).)

IHC (Immunohistchemistry)

(SHMT/SHMT2 Antibody-Immunohistochemistry of paraffin-embedded human lung using SHMT2 antibody at dilution of 1:200 (400x lens).)

product-image-AAA21303_IHC9.jpg IHC (Immunohistchemistry) (SHMT/SHMT2 Antibody-Immunohistochemistry of paraffin-embedded human lung using SHMT2 antibody at dilution of 1:200 (400x lens).)

IHC (Immunohistochemistry)

(SHMT/SHMT2 Antibody-Immunohistochemistry of paraffin-embedded rat kidney tissue.)

product-image-AAA21303_IHC8.jpg IHC (Immunohistochemistry) (SHMT/SHMT2 Antibody-Immunohistochemistry of paraffin-embedded rat kidney tissue.)

IHC (Immunohistochemistry)

(SHMT/SHMT2 Antibody-Immunohistochemistry of paraffin-embedded human liver cancer tissue.)

product-image-AAA21303_IHC7.jpg IHC (Immunohistochemistry) (SHMT/SHMT2 Antibody-Immunohistochemistry of paraffin-embedded human liver cancer tissue.)

IHC (Immunohistchemistry)

(SHMT/SHMT2 Antibody-Immunohistochemistry of paraffin-embedded human lung cancer tissue.)

product-image-AAA21303_IHC6.jpg IHC (Immunohistchemistry) (SHMT/SHMT2 Antibody-Immunohistochemistry of paraffin-embedded human lung cancer tissue.)

IHC (Immunohistochemistry)

(SHMT/SHMT2 Antibody-Human Colon: Formalin-Fixed, Paraffin-Embedded (FFPE))

product-image-AAA21303_IHC5.jpg IHC (Immunohistochemistry) (SHMT/SHMT2 Antibody-Human Colon: Formalin-Fixed, Paraffin-Embedded (FFPE))

WB (Western Blot)

(SHMT/SHMT2 Antibody-Western blot analysis of extracts of various cell lines, using SHMT2 antibody at 1:1000 dilution. The secondary antibody used was an HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates were loaded 25ug per lane and 3% nonfat dry milk in TBST was used for blocking. An ECL Kit was used for detection.)

product-image-AAA21303_WB4.jpg WB (Western Blot) (SHMT/SHMT2 Antibody-Western blot analysis of extracts of various cell lines, using SHMT2 antibody at 1:1000 dilution. The secondary antibody used was an HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates were loaded 25ug per lane and 3% nonfat dry milk in TBST was used for blocking. An ECL Kit was used for detection.)

ICC (Immunocytochemistry)

(SHMT/SHMT2 Antibody-Immunofluorescence analysis of HepG2 cell using SHMT2 antibody. Blue: DAPI for nuclear staining.)

product-image-AAA21303_ICC3.jpg ICC (Immunocytochemistry) (SHMT/SHMT2 Antibody-Immunofluorescence analysis of HepG2 cell using SHMT2 antibody. Blue: DAPI for nuclear staining.)

ICC (Immunocytochemistry)

(SHMT/SHMT2 Antibody-Immunofluorescence analysis of HeLa cells.)

product-image-AAA21303_ICC2.jpg ICC (Immunocytochemistry) (SHMT/SHMT2 Antibody-Immunofluorescence analysis of HeLa cells.)

ICC (Immunocytochemistry)

(SHMT/SHMT2 Antibody-Immunofluorescence analysis of HeLa cells using SHMT2 antibody. Blue: DAPI for nuclear staining.)

product-image-AAA21303_ICC.jpg ICC (Immunocytochemistry) (SHMT/SHMT2 Antibody-Immunofluorescence analysis of HeLa cells using SHMT2 antibody. Blue: DAPI for nuclear staining.)
Related Product Information for anti-SHMT2 antibody
SHMT2 antibody is an unconjugated rabbit polyclonal antibody to SHMT2 (SHMT) from human. It is reactive with human, mouse and rat. Validated for IF, IHC and WB. Tested on 20 paraffin-embedded human tissues.

NCBI and Uniprot Product Information

NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
UniProt Protein Name
Serine hydroxymethyltransferase, mitochondrial
UniProt Gene Name
SHMT2
UniProt Synonym Gene Names
SHMT
UniProt Entry Name
GLYM_HUMAN

Similar Products

Product Notes

The SHMT2 shmt2 (Catalog #AAA21303) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The SHMT/SHMT2 Rabbit anti-Human Polyclonal Antibody reacts with Mouse, Rat, Human and may cross-react with other species as described in the data sheet. AAA Biotech's SHMT/SHMT2 can be used in a range of immunoassay formats including, but not limited to, Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry-Paraffin (IHC-P), Western Blot (WB). IF: 1:50-1:200 IHC: 1:50-1:200 IHC-P: 1:200 WB: 1:500-1:2000 The predicted MW is 53kDa/54kDa/55kDa, while the observed MW by Western blot was 52kDa. Researchers should empirically determine the suitability of the SHMT2 shmt2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "SHMT/SHMT2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.