Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA197554_WB13.jpg WB (Western Blot) (WB Suggested Anti-SHOX2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: 721_B cell lysateSHOX2 is strongly supported by BioGPS gene expression data to be expressed in Human 721_B cells)

Rabbit SHOX2 Polyclonal Antibody | anti-SHOX2 antibody

SHOX2 antibody - N-terminal region

Average rating 0.0
No ratings yet
Gene Names
SHOX2; OG12; SHOT; OG12X
Reactivity
Cow, Dog, Guinea Pig, Human, Mouse, Rat, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
SHOX2, Antibody; SHOX2 antibody - N-terminal region; anti-SHOX2 antibody
Ordering
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Human, Mouse, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: EELTAFVSKSFDQKVKEKKEAITYREVLESGPLRGAKEPTGCTEAGRDDR
Sequence Length
331
Applicable Applications for anti-SHOX2 antibody
WB (Western Blot)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Human: 100%; Mouse: 100%; Rat: 100%; Zebrafish: 93%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human SHOX2
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-SHOX2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: 721_B cell lysateSHOX2 is strongly supported by BioGPS gene expression data to be expressed in Human 721_B cells)

product-image-AAA197554_WB13.jpg WB (Western Blot) (WB Suggested Anti-SHOX2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: 721_B cell lysateSHOX2 is strongly supported by BioGPS gene expression data to be expressed in Human 721_B cells)

WB (Western Blot)

(Host: RabbitTarget Name: SHOX2Sample Type: Human Fetal BrainAntibody Dilution: 1.0ug/ml)

product-image-AAA197554_WB15.jpg WB (Western Blot) (Host: RabbitTarget Name: SHOX2Sample Type: Human Fetal BrainAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-SHOX2 antibody
This is a rabbit polyclonal antibody against SHOX2. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: SHOX2 is a member of the homeo box family of genes that encode proteins containing a 60-amino acid residue motif that represents a DNA binding domain. Homeo box genes have been characterized extensively as transcriptional regulators involved in pattern formation in both invertebrate and vertebrate species. Several human genetic disorders are caused by aberrations in human homeo box genes. SHOX is a pseudoautosomal homeo box gene that is thought to be responsible for idiopathic short stature and implicated to play a role in the short stature phenotype of Turner syndrome patients. This gene is a member of the homeo box family of genes that encode proteins containing a 60-amino acid residue motif that represents a DNA binding domain. Homeo box genes have been characterized extensively as transcriptional regulators involved in pattern formation in both invertebrate and vertebrate species. Several human genetic disorders are caused by aberrations in human homeo box genes. SHOX is a pseudoautosomal homeo box gene that is thought to be responsible for idiopathic short stature and implicated to play a role in the short stature phenotype of Turner syndrome patients. This gene is considered to be a candidate gene for Cornelia de Lange syndrome. Alternative splicing has been observed at this locus and two variants, each encoding a distinct isoform, have been identified.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
35kDa
NCBI Official Full Name
short stature homeobox protein 2 isoform a
NCBI Official Synonym Full Names
short stature homeobox 2
NCBI Official Symbol
SHOX2
NCBI Official Synonym Symbols
OG12; SHOT; OG12X
NCBI Protein Information
short stature homeobox protein 2
UniProt Protein Name
Short stature homeobox protein 2
UniProt Gene Name
SHOX2
UniProt Synonym Gene Names
OG12X; SHOT
UniProt Entry Name
SHOX2_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The SHOX2 shox2 (Catalog #AAA197554) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The SHOX2 antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Human, Mouse, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's SHOX2 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the SHOX2 shox2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: EELTAFVSKS FDQKVKEKKE AITYREVLES GPLRGAKEPT GCTEAGRDDR. It is sometimes possible for the material contained within the vial of "SHOX2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.