Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us

Rabbit anti-Mouse SHTN1 Polyclonal Antibody | anti-SHTN1 antibody

SHTN1 Polyclonal Antibody

Gene Names
SHTN1; KIAA1598; shootin-1
Reactivity
Mouse
Applications
Western Blot
Purity
Affinity Purification
Synonyms
SHTN1, Antibody; SHTN1 Polyclonal Antibody; KIAA1598; shootin-1; anti-SHTN1 antibody
Ordering
Host
Rabbit
Reactivity
Mouse
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity Purification
Sequence
MNSSDEEKQLQLITSLKEQAIGEYEDLRAENQKTKEKCDKIRQERDEAVKKLEEFQKISHMVIEEVNFMQNHLEIEKTCRESAEALATKLNKENKTLKRISMLYMAKLGPDVITEEINIDDEDSTTDTDGAAETCVSVQCQKQIKELRDQIVSVQEEKKILAIELENLKSKLVEVIEEVNKVKQEKTVLNSEVLEQRKVLEKCNRVSMLAVEEYEEMQVNLELEKDLRKKAESFAQEMFIEQNKLKRQSHLLLQS
Sequence Length
631
Applicable Applications for anti-SHTN1 antibody
WB (Western Blot)
Immunogen
Recombinant protein of human SHTN1
Buffer
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Preparation and Storage
Store at -20 degree C. Avoid freeze / thaw cycles.
Product Categories/Family for anti-SHTN1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
23kDa, 52-73kDa
NCBI Official Full Name
shootin-1 isoform a
NCBI Official Synonym Full Names
shootin 1
NCBI Official Symbol
SHTN1
NCBI Official Synonym Symbols
KIAA1598; shootin-1
NCBI Protein Information
shootin-1
UniProt Protein Name
Shootin-1
UniProt Gene Name
SHTN1

Similar Products

Product Notes

The SHTN1 shtn1 (Catalog #AAA281252) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The SHTN1 Polyclonal Antibody reacts with Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's SHTN1 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the SHTN1 shtn1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MNSSDEEKQL QLITSLKEQA IGEYEDLRAE NQKTKEKCDK IRQERDEAVK KLEEFQKISH MVIEEVNFMQ NHLEIEKTCR ESAEALATKL NKENKTLKRI SMLYMAKLGP DVITEEINID DEDSTTDTDG AAETCVSVQC QKQIKELRDQ IVSVQEEKKI LAIELENLKS KLVEVIEEVN KVKQEKTVLN SEVLEQRKVL EKCNRVSMLA VEEYEEMQVN LELEKDLRKK AESFAQEMFI EQNKLKRQSH LLLQS. It is sometimes possible for the material contained within the vial of "SHTN1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.