WB (Western Blot)
(WB Suggested Anti-SIAH1 Antibody Titration: 1.25ug/mlELISA Titer: 1:312500Positive Control: Human Placenta)
Rabbit SIAH1 Polyclonal Antibody | anti-SIAH1 antibody
SIAH1 antibody - C-terminal region
Gene Names
SIAH1; SIAH1A
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Western Blot, Immunohistochemistry
Purity
Protein A purified
Synonyms
SIAH1, Antibody; SIAH1 antibody - C-terminal region; anti-SIAH1 antibody
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Protein A purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: LVLEKQEKYDGHQQFFAIVQLIGTRKQAENFAYRLELNGHRRRLTWEATP
Sequence Length
282
Applicable Applications for anti-SIAH1 antibody
WB (Western Blot), IHC (Immunohistochemistry)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human SIAH1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
WB (Western Blot)
(WB Suggested Anti-SIAH1 Antibody Titration: 1.25ug/mlELISA Titer: 1:312500Positive Control: Human Placenta)
WB (Western Blot)
(WB Suggested Anti-SIAH1 Antibody Titration: 1.25ug/mlELISA Titer: 1:312500Positive Control: Human Placenta)
WB (Western Blot)
(Lanes:Lane1: 50 ug human HEK-293T lysatePrimary Antibody Dilution:1:1000Secondary Antibody:Anti-rabbit-IgGSecondary Antibody Dilution:1:5000Gene Name:SIAH1Submitted by:Peter Brand & Dr. Oliver Kramer, Institute for Biochemistry and Biophysics, Center for Molecular Biomedicine, Friedrich-Schiller University JenaSIAH1 is strongly supported by BioGPS gene expression data to be expressed in Human HEK293T cells)
WB (Western Blot)
(Lanes:Lane1: 50 ug human HEK-293T lysatePrimary Antibody Dilution:1:1000Secondary Antibody:Anti-rabbit-IgGSecondary Antibody Dilution:1:5000Gene Name:SIAH1Submitted by:Peter Brand & Dr. Oliver Kramer, Institute for Biochemistry and Biophysics, Center for Molecular Biomedicine, Friedrich-Schiller University JenaSIAH1 is strongly supported by BioGPS gene expression data to be expressed in Human HEK293T cells)
IHC (Immunohistochemistry)
(Liver)
IHC (Immunohistochemistry)
(Liver)
Related Product Information for anti-SIAH1 antibody
This is a rabbit polyclonal antibody against SIAH1. It was validated on Western Blot using a cell lysate as a positive control.
Target Description: SIAH1 is a protein that is a member of the seven in absentia homolog (SIAH) family. The protein is an E3 ligase and is involved in ubiquitination and proteasome-mediated degradation of specific proteins. The activity of this ubiquitin ligase has been implicated in the development of certain forms of Parkinson's disease, the regulation of the cellular response to hypoxia and induction of apoptosis. Alternative splicing results in several additional transcript variants, some encoding different isoforms and others that have not been fully characterizedThis gene encodes a protein that is a member of the seven in absentia homolog (SIAH) family. The protein is an E3 ligase and is involved in ubiquitination and proteasome-mediated degradation of specific proteins. The activity of this ubiquitin ligase has been implicated in the development of certain forms of Parkinson's disease, the regulation of the cellular response to hypoxia and induction of apoptosis. Alternative splicing results in several additional transcript variants, some encoding different isoforms and others that have not been fully characterized.
Target Description: SIAH1 is a protein that is a member of the seven in absentia homolog (SIAH) family. The protein is an E3 ligase and is involved in ubiquitination and proteasome-mediated degradation of specific proteins. The activity of this ubiquitin ligase has been implicated in the development of certain forms of Parkinson's disease, the regulation of the cellular response to hypoxia and induction of apoptosis. Alternative splicing results in several additional transcript variants, some encoding different isoforms and others that have not been fully characterizedThis gene encodes a protein that is a member of the seven in absentia homolog (SIAH) family. The protein is an E3 ligase and is involved in ubiquitination and proteasome-mediated degradation of specific proteins. The activity of this ubiquitin ligase has been implicated in the development of certain forms of Parkinson's disease, the regulation of the cellular response to hypoxia and induction of apoptosis. Alternative splicing results in several additional transcript variants, some encoding different isoforms and others that have not been fully characterized.
Product Categories/Family for anti-SIAH1 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
31kDa
NCBI Official Full Name
E3 ubiquitin-protein ligase SIAH1 isoform a
NCBI Official Synonym Full Names
siah E3 ubiquitin protein ligase 1
NCBI Official Symbol
SIAH1
NCBI Official Synonym Symbols
SIAH1A
NCBI Protein Information
E3 ubiquitin-protein ligase SIAH1
UniProt Protein Name
E3 ubiquitin-protein ligase SIAH1
UniProt Gene Name
SIAH1
UniProt Synonym Gene Names
HUMSIAH; Siah-1
UniProt Entry Name
SIAH1_HUMAN
Similar Products
Product Notes
The SIAH1 siah1 (Catalog #AAA198267) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The SIAH1 antibody - C-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's SIAH1 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot), IHC (Immunohistochemistry). Researchers should empirically determine the suitability of the SIAH1 siah1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: LVLEKQEKYD GHQQFFAIVQ LIGTRKQAEN FAYRLELNGH RRRLTWEATP. It is sometimes possible for the material contained within the vial of "SIAH1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.