Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA199494_WB8.jpg WB (Western Blot) (WB Suggested Anti-SIL1 antibody Titration: 1 ug/mLSample Type: Human heart)

Rabbit SIL1 Polyclonal Antibody | anti-SIL1 antibody

SIL1 antibody - C-terminal region

Average rating 0.0
No ratings yet
Gene Names
SIL1; BAP; MSS; ULG5
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
SIL1, Antibody; SIL1 antibody - C-terminal region; anti-SIL1 antibody
Ordering
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: KLQQYRQVHLLPGLWEQGWCEITAHLLALPEHDAREKVLQTLGVLLTTCR
Sequence Length
461
Applicable Applications for anti-SIL1 antibody
WB (Western Blot)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human SIL1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-SIL1 antibody Titration: 1 ug/mLSample Type: Human heart)

product-image-AAA199494_WB8.jpg WB (Western Blot) (WB Suggested Anti-SIL1 antibody Titration: 1 ug/mLSample Type: Human heart)

WB (Western Blot)

(WB Suggested Anti-SIL1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Hela cell lysateSIL1 is supported by BioGPS gene expression data to be expressed in HeLa)

product-image-AAA199494_WB10.jpg WB (Western Blot) (WB Suggested Anti-SIL1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Hela cell lysateSIL1 is supported by BioGPS gene expression data to be expressed in HeLa)

WB (Western Blot)

(Host: RabbitTarget Name: SIL1Sample Type: Human Fetal HeartAntibody Dilution: 1.0ug/ml)

product-image-AAA199494_WB11.jpg WB (Western Blot) (Host: RabbitTarget Name: SIL1Sample Type: Human Fetal HeartAntibody Dilution: 1.0ug/ml)

IHC (Immunohiostchemistry)

(Rabbit Anti-BAP / SIL1 antibodyFormalin Fixed Paraffin Embedded Tissue: Human Adult TestisObserved Staining: Cytoplasm in hepatocytesPrimary Antibody Concentration: 1:600Secondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)

product-image-AAA199494_IHC13.jpg IHC (Immunohiostchemistry) (Rabbit Anti-BAP / SIL1 antibodyFormalin Fixed Paraffin Embedded Tissue: Human Adult TestisObserved Staining: Cytoplasm in hepatocytesPrimary Antibody Concentration: 1:600Secondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)

IHC (Immunohistochemistry)

(Rabbit Anti-BAP / SIL1 antibodyFormalin Fixed Paraffin Embedded Tissue: Human Adult ProstateObserved Staining: Cytoplasm in hepatocytesPrimary Antibody Concentration: 1:600Secondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)

product-image-AAA199494_IHC15.jpg IHC (Immunohistochemistry) (Rabbit Anti-BAP / SIL1 antibodyFormalin Fixed Paraffin Embedded Tissue: Human Adult ProstateObserved Staining: Cytoplasm in hepatocytesPrimary Antibody Concentration: 1:600Secondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)
Related Product Information for anti-SIL1 antibody
This is a rabbit polyclonal antibody against SIL1. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: SIL1 is a resident endoplasmic reticulum (ER), N-linked glycoprotein with an N-terminal ER targeting sequence, 2 putative N-glycosylation sites, and a C-terminal ER retention signal. This protein functions as a nucleotide exchange factor for another unfolded protein response protein. Mutations in its gene have been associated with Marinesco-Sjogren syndrome.This gene encodes a resident endoplasmic reticulum (ER), N-linked glycoprotein with an N-terminal ER targeting sequence, 2 putative N-glycosylation sites, and a C-terminal ER retention signal. This protein functions as a nucleotide exchange factor for another unfolded protein response protein. Mutations in this gene have been associated with Marinesco-Sjogren syndrome. Alternate transcriptional splice variants have been characterized.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
49kDa
NCBI Official Full Name
nucleotide exchange factor SIL1
NCBI Official Synonym Full Names
SIL1 nucleotide exchange factor
NCBI Official Symbol
SIL1
NCBI Official Synonym Symbols
BAP; MSS; ULG5
NCBI Protein Information
nucleotide exchange factor SIL1
UniProt Protein Name
Nucleotide exchange factor SIL1
UniProt Gene Name
SIL1
UniProt Synonym Gene Names
BAP
UniProt Entry Name
SIL1_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The SIL1 sil1 (Catalog #AAA199494) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The SIL1 antibody - C-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's SIL1 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the SIL1 sil1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: KLQQYRQVHL LPGLWEQGWC EITAHLLALP EHDAREKVLQ TLGVLLTTCR. It is sometimes possible for the material contained within the vial of "SIL1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request Manual

Please complete the form below and a representative will contact you as soon as possible.

Request Quote

Please complete the form below and a representative will contact you as soon as possible.