Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA199046_WB10.jpg WB (Western Blot) (WB Suggested Anti-SLC10A1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: HT1080 cell lysate)

Rabbit SLC10A1 Polyclonal Antibody | anti-SLC10A1 antibody

SLC10A1 antibody - middle region

Gene Names
SLC10A1; NTCP
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
SLC10A1, Antibody; SLC10A1 antibody - middle region; anti-SLC10A1 antibody
Ordering
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: VFSLAMKGDMNLSIVMTTCSTFCALGMMPLLLYIYSRGIYDGDLKDKVPY
Sequence Length
349
Applicable Applications for anti-SLC10A1 antibody
WB (Western Blot)
Homology
Cow: 93%; Dog: 100%; Guinea Pig: 100%; Horse: 93%; Human: 100%; Mouse: 100%; Rabbit: 93%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human SLC10A1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-SLC10A1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: HT1080 cell lysate)

product-image-AAA199046_WB10.jpg WB (Western Blot) (WB Suggested Anti-SLC10A1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: HT1080 cell lysate)

WB (Western Blot)

(Host: RabbitTarget Name: SLC10A1Sample Type: HT1080Lane A: Primary AntibodyLane B: Primary Antibody + Blocking PeptidePrimary Antibody Concentration: 1ug/mlPeptide Concentration: 5ug/mlLysate Quantity: 25ug/lane/laneGel Concentration: 0.12)

product-image-AAA199046_WB11.jpg WB (Western Blot) (Host: RabbitTarget Name: SLC10A1Sample Type: HT1080Lane A: Primary AntibodyLane B: Primary Antibody + Blocking PeptidePrimary Antibody Concentration: 1ug/mlPeptide Concentration: 5ug/mlLysate Quantity: 25ug/lane/laneGel Concentration: 0.12)

WB (Western Blot)

(Host: RabbitTarget Name: SLC10A1Sample Tissue: Human MDA-MB-435sAntibody Dilution: 1.0ug/ml)

product-image-AAA199046_WB13.jpg WB (Western Blot) (Host: RabbitTarget Name: SLC10A1Sample Tissue: Human MDA-MB-435sAntibody Dilution: 1.0ug/ml)

WB (Western Blot)

(Host: RabbitTarget Name: SLC10A1Sample Tissue: Human Jurkat Whole CellAntibody Dilution: 1ug/ml)

product-image-AAA199046_WB15.jpg WB (Western Blot) (Host: RabbitTarget Name: SLC10A1Sample Tissue: Human Jurkat Whole CellAntibody Dilution: 1ug/ml)
Related Product Information for anti-SLC10A1 antibody
This is a rabbit polyclonal antibody against SLC10A1. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: Sodium/bile acid cotransporters are integral membrane glycoproteins that participate in the enterohepatic circulation of bile acids. Two homologous transporters are involved in the reabsorption of bile acids, one absorbing from the intestinal lumen, the b
Product Categories/Family for anti-SLC10A1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
38kDa
NCBI Official Full Name
sodium/bile acid cotransporter
NCBI Official Synonym Full Names
solute carrier family 10 member 1
NCBI Official Symbol
SLC10A1
NCBI Official Synonym Symbols
NTCP
NCBI Protein Information
sodium/bile acid cotransporter
UniProt Protein Name
Sodium/bile acid cotransporter
UniProt Gene Name
SLC10A1
UniProt Synonym Gene Names
NTCP
UniProt Entry Name
NTCP_HUMAN

Similar Products

Product Notes

The SLC10A1 slc10a1 (Catalog #AAA199046) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The SLC10A1 antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's SLC10A1 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the SLC10A1 slc10a1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: VFSLAMKGDM NLSIVMTTCS TFCALGMMPL LLYIYSRGIY DGDLKDKVPY. It is sometimes possible for the material contained within the vial of "SLC10A1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.