WB (Western Blot)
(WB Suggested Anti-SLC14A1 Antibody Titration: 0.25ug/mlPositive Control: Jurkat cell lysate)
Rabbit SLC14A1 Polyclonal Antibody | anti-SLC14A1 antibody
SLC14A1 antibody - C-terminal region
Gene Names
SLC14A1; JK; UT1; UTE; HUT11; RACH1; RACH2; UT-B1; HsT1341
Reactivity
Cow, Dog, Goat, Horse, Human, Mouse, Pig, Sheep
Applications
Western Blot, Immunohistochemistry
Purity
Affinity Purified
Synonyms
SLC14A1, Antibody; SLC14A1 antibody - C-terminal region; anti-SLC14A1 antibody
Host
Rabbit
Reactivity
Cow, Dog, Goat, Horse, Human, Mouse, Pig, Sheep
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: LSSPLMCLHAAIGSLLGIAAGLSLSAPFENIYFGLWGFNSSLACIAMGGM
Sequence Length
389
Applicable Applications for anti-SLC14A1 antibody
WB (Western Blot), IHC (Immunohistochemistry)
Homology
Cow: 86%; Dog: 93%; Goat: 93%; Horse: 83%; Human: 100%; Mouse: 83%; Pig: 93%; Sheep: 93%
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human SLC14A1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
WB (Western Blot)
(WB Suggested Anti-SLC14A1 Antibody Titration: 0.25ug/mlPositive Control: Jurkat cell lysate)
WB (Western Blot)
(WB Suggested Anti-SLC14A1 Antibody Titration: 0.25ug/mlPositive Control: Jurkat cell lysate)
WB (Western Blot)
(Host: RabbitTarget Name: SLC14A1Sample Tissue: Human Hela Whole CellAntibody Dilution: 1ug/ml)
WB (Western Blot)
(Host: RabbitTarget Name: SLC14A1Sample Tissue: Human Hela Whole CellAntibody Dilution: 1ug/ml)
IHC (Immunohistochemistry)
(Human kidney)
IHC (Immunohistochemistry)
(Human kidney)
Related Product Information for anti-SLC14A1 antibody
This is a rabbit polyclonal antibody against SLC14A1. It was validated on Western Blot and immunohistochemistry
Target Description: SLC14A1 is a specialized low-affinity urea transporter. It mediates urea transport in erythrocytes.
Target Description: SLC14A1 is a specialized low-affinity urea transporter. It mediates urea transport in erythrocytes.
Product Categories/Family for anti-SLC14A1 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
42kDa
NCBI Official Full Name
urea transporter 1 isoform 2
NCBI Official Synonym Full Names
solute carrier family 14 member 1 (Kidd blood group)
NCBI Official Symbol
SLC14A1
NCBI Official Synonym Symbols
JK; UT1; UTE; HUT11; RACH1; RACH2; UT-B1; HsT1341
NCBI Protein Information
urea transporter 1
UniProt Protein Name
Urea transporter 1
UniProt Gene Name
SLC14A1
UniProt Synonym Gene Names
HUT11; JK; RACH1; UT1; UTE
UniProt Entry Name
UT1_HUMAN
Similar Products
Product Notes
The SLC14A1 slc14a1 (Catalog #AAA199860) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The SLC14A1 antibody - C-terminal region reacts with Cow, Dog, Goat, Horse, Human, Mouse, Pig, Sheep and may cross-react with other species as described in the data sheet. AAA Biotech's SLC14A1 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot), IHC (Immunohistochemistry). Researchers should empirically determine the suitability of the SLC14A1 slc14a1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: LSSPLMCLHA AIGSLLGIAA GLSLSAPFEN IYFGLWGFNS SLACIAMGGM. It is sometimes possible for the material contained within the vial of "SLC14A1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.