Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA197674_WB13.jpg WB (Western Blot) (WB Suggested Anti-SLC1A2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:12500Positive Control: HT1080 cell lysate)

Rabbit SLC1A2 Polyclonal Antibody | anti-SLC1A2 antibody

SLC1A2 antibody - middle region

Average rating 0.0
No ratings yet
Gene Names
SLC1A2; HBGT; EAAT2; GLT-1; EIEE41
Reactivity
Tested Reactivity: Human
Predicted Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
Applications
Western Blot, Immunohistochemistry
Purity
Affinity Purified
Synonyms
SLC1A2, Antibody; SLC1A2 antibody - middle region; anti-SLC1A2 antibody
Ordering
Host
Rabbit
Reactivity
Tested Reactivity: Human
Predicted Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration
0.5mg/ml (varies by lot)
Sequence
LVAVDWLLDRMRTSVNVVGDSFGAGIVYHLSKSELDTIDSQHRVHEDIEM
Applicable Applications for anti-SLC1A2 antibody
WB (Western Blot), IHC (Immunohistochemistry)
Protein Size (# AA)
574 amino acids
Protein Interactions
PML; GRB2; AJUBA; SLC1A2; MYCN; RELA;
Blocking Peptide
For anti-SLC1A2 (MBS3201745) antibody is Catalog #
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human SLC1A2
Predicted Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 92%
Replacement Item
This antibody may replace item sc-135892 from Santa Cruz Biotechnology.
Preparation and Storage
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-SLC1A2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:12500Positive Control: HT1080 cell lysate)

product-image-AAA197674_WB13.jpg WB (Western Blot) (WB Suggested Anti-SLC1A2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:12500Positive Control: HT1080 cell lysate)

IHC (Immunohistochemistry)

(Sample Type: Human brainAnti-SLC1A2 / EAAT2 antibody IHC of human brain, cortex. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. SLC1A2 Antibody concentration 5 ug/ml.)

product-image-AAA197674_IHC15.jpg IHC (Immunohistochemistry) (Sample Type: Human brainAnti-SLC1A2 / EAAT2 antibody IHC of human brain, cortex. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. SLC1A2 Antibody concentration 5 ug/ml.)
Related Product Information for anti-SLC1A2 antibody
SLC1A2 is a member of a family of solute transporter proteins. The membrane-bound protein is the principal transporter that clears the excitatory neurotransmitter glutamate from the extracellular space at synapses in the central nervous system. Glutamate clearance is necessary for proper synaptic activation and to prevent neuronal damage from excessive activation of glutamate receptors. Mutations in and decreased expression of this protein are associated with amyotrophic lateral sclerosis. Alternatively spliced transcript variants of this gene have been described, but their full-length nature is not known. This gene encodes a member of a family of solute transporter proteins. The membrane-bound protein is the principal transporter that clears the excitatory neurotransmitter glutamate from the extracellular space at synapses in the central nervous system. Glutamate clearance is necessary for proper synaptic activation and to prevent neuronal damage from excessive activation of glutamate receptors. Mutations in and decreased expression of this protein are associated with amyotrophic lateral sclerosis. Alternatively spliced transcript variants of this gene have been described, but their full-length nature is not known. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
62kDa
NCBI Official Full Name
excitatory amino acid transporter 2 isoform 1
NCBI Official Synonym Full Names
solute carrier family 1 member 2
NCBI Official Symbol
SLC1A2
NCBI Official Synonym Symbols
HBGT; EAAT2; GLT-1; EIEE41
NCBI Protein Information
excitatory amino acid transporter 2
UniProt Protein Name
Excitatory amino acid transporter 2
UniProt Gene Name
SLC1A2
UniProt Synonym Gene Names
EAAT2; GLT1
UniProt Entry Name
EAA2_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The SLC1A2 slc1a2 (Catalog #AAA197674) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The SLC1A2 antibody - middle region reacts with Tested Reactivity: Human Predicted Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's SLC1A2 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot), IHC (Immunohistochemistry). Researchers should empirically determine the suitability of the SLC1A2 slc1a2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: LVAVDWLLDR MRTSVNVVGD SFGAGIVYHL SKSELDTIDS QHRVHEDIEM. It is sometimes possible for the material contained within the vial of "SLC1A2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.