Rabbit SLC25A5 Polyclonal Antibody | anti-SLC25A5 antibody
SLC25A5 Polyclonal Antibody
Gene Names
SLC25A5; T2; T3; 2F1; AAC2; ANT2
Reactivity
Human, Mouse, Rat
Applications
Immunofluorescence, Western Blot
Purity
Affinity Purification
Synonyms
SLC25A5, Antibody; SLC25A5 Polyclonal Antibody; SLC25A5; 2F1; AAC2; ANT2; T2; T3; ADP/ATP translocase 2; anti-SLC25A5 antibody
Host
Rabbit
Reactivity
Human, Mouse, Rat
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity Purification
Form/Format
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Concentration
1.16 mg/ml (varies by lot)
Sequence Length
298
Applicable Applications for anti-SLC25A5 antibody
IF (Immunofluorescence), WB (Western Blot)
Immunogen
A synthetic peptide corresponding to a sequence within amino acids 150-250 of human SLC25A5 (NP_001143.2).
Immunogen Sequence
AEREFRGLGDCLVKIYKSDGIKGLYQGFNVSVQGIIIYRAAYFGIYDTAKGMLPDPKNTHIVISWMIAQTVTAVAGLTSYPFDTVRRRMMMQSGRKGTDIM
Positive Samples
293T, LO2, Mouse Brain, Mouse Heart, Mouse Kidney, Rat Kidney, Rat Brain
Cellular Location
Mitochondrion Inner Membrane, Multi-Pass Membrane Protein
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.
Related Product Information for anti-SLC25A5 antibody
This gene is a member of the mitochondrial carrier subfamily of solute carrier protein genes. The product of this gene functions as a gated pore that translocates ADP from the cytoplasm into the mitochondrial matrix and ATP from the mitochondrial matrix into the cytoplasm. The protein forms a homodimer embedded in the inner mitochondria membrane. Suppressed expression of this gene has been shown to induce apoptosis and inhibit tumor growth. The human genome contains several non-transcribed pseudogenes of this gene.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
Calculated: 32kDa
Observed: 33kDa
Observed: 33kDa
NCBI Official Full Name
ADP/ATP translocase 2
NCBI Official Synonym Full Names
solute carrier family 25 member 5
NCBI Official Symbol
SLC25A5
NCBI Official Synonym Symbols
T2; T3; 2F1; AAC2; ANT2
NCBI Protein Information
ADP/ATP translocase 2
UniProt Protein Name
ADP/ATP translocase 2
UniProt Gene Name
SLC25A5
UniProt Synonym Gene Names
ANT2; ANT 2
Similar Products
Product Notes
The SLC25A5 slc25a5 (Catalog #AAA281438) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The SLC25A5 Polyclonal Antibody reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's SLC25A5 can be used in a range of immunoassay formats including, but not limited to, IF (Immunofluorescence), WB (Western Blot). Researchers should empirically determine the suitability of the SLC25A5 slc25a5 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "SLC25A5, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
