WB (Western Blot)
(WB Suggested Anti-SLC26A1 Antibody Titration: 0.2-1 ug/mlPositive Control: HepG2 cell lysate)
Rabbit anti-Human SLC26A1 Polyclonal Antibody | anti-SLC26A1 antibody
SLC26A1 antibody - C-terminal region
Gene Names
SLC26A1; CAON; EDM4; SAT1; SAT-1
Reactivity
Human
Applications
Western Blot, Immunohistochemistry
Purity
Affinity Purified
Synonyms
SLC26A1, Antibody; SLC26A1 antibody - C-terminal region; anti-SLC26A1 antibody
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: LYSLTGLDAGCMAARRKEGGSETGVGEGGPAQGEDLGPVSTRAALVPAAA
Sequence Length
701
Applicable Applications for anti-SLC26A1 antibody
WB (Western Blot), IHC (Immunohistochemistry)
Homology
Human: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human SLC26A1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
WB (Western Blot)
(WB Suggested Anti-SLC26A1 Antibody Titration: 0.2-1 ug/mlPositive Control: HepG2 cell lysate)
WB (Western Blot)
(WB Suggested Anti-SLC26A1 Antibody Titration: 0.2-1 ug/mlPositive Control: HepG2 cell lysate)
IHC (Immunohistochemistry)
(Human Skin)
IHC (Immunohistochemistry)
(Human Skin)
Related Product Information for anti-SLC26A1 antibody
This is a rabbit polyclonal antibody against SLC26A1. It was validated on Western Blot and immunohistochemistry
Target Description: SLC26A1 is a member of sulfate/anion transporter family. Family members are well conserved in their protein (aa length among species) structures, but have markedly different tissue expression patterns. Its gene is primarily expressed in the liver, pancreas, and brain.This gene is a member of a family of sulfate/anion transporter genes. Family members are well conserved in their genomic (number and size of exons) and protein (aa length among species) structures, but have markedly different tissue expression patterns. This gene is primarily expressed in the liver, pancreas, and brain. Three splice variants that encode different isoforms have been identified.
Target Description: SLC26A1 is a member of sulfate/anion transporter family. Family members are well conserved in their protein (aa length among species) structures, but have markedly different tissue expression patterns. Its gene is primarily expressed in the liver, pancreas, and brain.This gene is a member of a family of sulfate/anion transporter genes. Family members are well conserved in their genomic (number and size of exons) and protein (aa length among species) structures, but have markedly different tissue expression patterns. This gene is primarily expressed in the liver, pancreas, and brain. Three splice variants that encode different isoforms have been identified.
Product Categories/Family for anti-SLC26A1 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
77kDa
NCBI Official Full Name
sulfate anion transporter 1 isoform a
NCBI Official Synonym Full Names
solute carrier family 26 member 1
NCBI Official Symbol
SLC26A1
NCBI Official Synonym Symbols
CAON; EDM4; SAT1; SAT-1
NCBI Protein Information
sulfate anion transporter 1
UniProt Protein Name
Sulfate anion transporter 1
UniProt Gene Name
SLC26A1
UniProt Synonym Gene Names
SAT1; SAT-1
UniProt Entry Name
S26A1_HUMAN
Similar Products
Product Notes
The SLC26A1 slc26a1 (Catalog #AAA199365) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The SLC26A1 antibody - C-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's SLC26A1 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot), IHC (Immunohistochemistry). Researchers should empirically determine the suitability of the SLC26A1 slc26a1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: LYSLTGLDAG CMAARRKEGG SETGVGEGGP AQGEDLGPVS TRAALVPAAA. It is sometimes possible for the material contained within the vial of "SLC26A1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.