Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA23387_APP6.jpg Application Data (Surface Plasmon Resonance Kinetic Characterization of Polyclonal Antibody Affinity. Purified polyclonal antibodies were immobilized on a Protein A/G coated Carterra LSA sensor chip at concentrations of 5, and 50 ug/mL in duplicate. Antibodies on the surface were exposed to interaction with peptides sequentially via microfluidic controlled flow at 333nM peptide concentration for kinetic characterization of the binders for affinity and specificity, followed by curve fitting using the Kinetics software. Kd determinations for both concentrations were averaged and results and standard deviation are shown.)

Rabbit SLC26A3 Polyclonal Antibody | anti-SLC26A3 antibody

SLC26A3 antibody - middle region

Gene Names
SLC26A3; CLD; DRA
Reactivity
Tested Reactivity: Human
Predicted Reactivity: Cow, Dog, Guinea Pig, Human, Mouse, Pig, Rabbit, Rat, Sheep
Applications
Western Blot, Immunohistochemistry
Purity
Affinity Purified
Synonyms
SLC26A3, Antibody; SLC26A3 antibody - middle region; anti-SLC26A3 antibody
Ordering
Host
Rabbit
Reactivity
Tested Reactivity: Human
Predicted Reactivity: Cow, Dog, Guinea Pig, Human, Mouse, Pig, Rabbit, Rat, Sheep
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration
0.5 mg/ml (varies by lot)
Sequence
DAVLHILMKKDYSTSKFNPSQEKDGKIDFTINTNGGLRNRVYEVPVETKF
Applicable Applications for anti-SLC26A3 antibody
WB (Western Blot), IHC (Immunohistochemistry)
Protein Size (# AA)
764 amino acids
Protein Interactions
SLC9A3R1; SLC9A3R2;
Blocking Peptide
For anti-SLC26A3 antibody
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human SLC26A3
Predicted Homology
Cow: 100%; Dog: 79%; Guinea Pig: 79%; Human: 100%; Mouse: 93%; Pig: 100%; Rabbit: 86%; Rat: 93%; Sheep: 100%
Replacement Item
This antibody may replace item sc-114083 from Santa Cruz Biotechnology.
Preparation and Storage
For short term use, store at 2°C to 8°C up to 1 week. For long term storage, store at -20°C in small aliquots to prevent freeze-thaw cycles.

Application Data

(Surface Plasmon Resonance Kinetic Characterization of Polyclonal Antibody Affinity. Purified polyclonal antibodies were immobilized on a Protein A/G coated Carterra LSA sensor chip at concentrations of 5, and 50 ug/mL in duplicate. Antibodies on the surface were exposed to interaction with peptides sequentially via microfluidic controlled flow at 333nM peptide concentration for kinetic characterization of the binders for affinity and specificity, followed by curve fitting using the Kinetics software. Kd determinations for both concentrations were averaged and results and standard deviation are shown.)

product-image-AAA23387_APP6.jpg Application Data (Surface Plasmon Resonance Kinetic Characterization of Polyclonal Antibody Affinity. Purified polyclonal antibodies were immobilized on a Protein A/G coated Carterra LSA sensor chip at concentrations of 5, and 50 ug/mL in duplicate. Antibodies on the surface were exposed to interaction with peptides sequentially via microfluidic controlled flow at 333nM peptide concentration for kinetic characterization of the binders for affinity and specificity, followed by curve fitting using the Kinetics software. Kd determinations for both concentrations were averaged and results and standard deviation are shown.)

WB (Western Blot)

(Human HeartWB Suggested Anti-SLC26A3 antibody Titration: 1 ug/mLSample Type: Human heart)

product-image-AAA23387_WB5.jpg WB (Western Blot) (Human HeartWB Suggested Anti-SLC26A3 antibody Titration: 1 ug/mLSample Type: Human heart)

WB (Western Blot)

(Human PancreasWB Suggested Anti-SLC26A3 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Human Placenta)

product-image-AAA23387_WB4.jpg WB (Western Blot) (Human PancreasWB Suggested Anti-SLC26A3 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Human Placenta)

WB (Western Blot)

(Human HepG2Host: RabbitTarget Name: SLC26A3Sample Type: HepG2Antibody Dilution: 1.0ug/mlSLC26A3 is supported by BioGPS gene expression data to be expressed in HepG2)

product-image-AAA23387_WB3.jpg WB (Western Blot) (Human HepG2Host: RabbitTarget Name: SLC26A3Sample Type: HepG2Antibody Dilution: 1.0ug/mlSLC26A3 is supported by BioGPS gene expression data to be expressed in HepG2)

IHC (Immunohistochemistry)

(LiverCatalog Number: AAA23387Rabbit Anti-SLC26A3 AntibodyFormalin Fixed Paraffin Embedded Tissue: Human Adult liverObserved Staining: Cytoplasmic,NuclearPrimary Antibody Concentration: 1:600Secondary Antibody: Donkey anti-Rabbit-Cy2/3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 secProtocol located in Reviews and Data.)

product-image-AAA23387_IHC2.jpg IHC (Immunohistochemistry) (LiverCatalog Number: AAA23387Rabbit Anti-SLC26A3 AntibodyFormalin Fixed Paraffin Embedded Tissue: Human Adult liverObserved Staining: Cytoplasmic,NuclearPrimary Antibody Concentration: 1:600Secondary Antibody: Donkey anti-Rabbit-Cy2/3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 secProtocol located in Reviews and Data.)

IHC (Immunohistochemistry)

(HeartRabbit Anti-SLC26A3 AntibodyCatalog Number: AAA23387Formalin Fixed Paraffin Embedded Tissue: Human Adult heartObserved Staining: MembranePrimary Antibody Concentration: 1:100Secondary Antibody: Donkey anti-Rabbit-Cy2/3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 secProtocol located in Reviews and Data.)

product-image-AAA23387_IHC.jpg IHC (Immunohistochemistry) (HeartRabbit Anti-SLC26A3 AntibodyCatalog Number: AAA23387Formalin Fixed Paraffin Embedded Tissue: Human Adult heartObserved Staining: MembranePrimary Antibody Concentration: 1:100Secondary Antibody: Donkey anti-Rabbit-Cy2/3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 secProtocol located in Reviews and Data.)
Related Product Information for anti-SLC26A3 antibody
SLC26A3 is a transmembrane glycoprotein that transports chloride ions across the cell membrane in exchange for bicarbonate ions. It is localized to the mucosa of the lower intestinal tract, particularly to the apical membrane of columnar epithelium and some goblet cells. The protein is essential for intestinal chloride absorption, and mutations in this gene have been associated with congenital chloride diarrhea.The protein encoded by this gene is a transmembrane glycoprotein that functions as a sulfate transporter. It is localized to the mucosa of the lower intestinal tract, particularly to the apical membrane of columnar epithelium and some goblet cells. Mutations in this gene have been associated with congenital chloride diarrhea. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
84kDa
NCBI Official Full Name
chloride anion exchanger
NCBI Official Synonym Full Names
solute carrier family 26 member 3
NCBI Official Symbol
SLC26A3
NCBI Official Synonym Symbols
CLD; DRA
NCBI Protein Information
chloride anion exchanger
UniProt Protein Name
Chloride anion exchanger
UniProt Gene Name
SLC26A3
UniProt Synonym Gene Names
DRA; Protein DRA

Similar Products

Product Notes

The SLC26A3 slc26a3 (Catalog #AAA23387) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The SLC26A3 antibody - middle region reacts with Tested Reactivity: Human Predicted Reactivity: Cow, Dog, Guinea Pig, Human, Mouse, Pig, Rabbit, Rat, Sheep and may cross-react with other species as described in the data sheet. AAA Biotech's SLC26A3 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot), IHC (Immunohistochemistry). Researchers should empirically determine the suitability of the SLC26A3 slc26a3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: DAVLHILMKK DYSTSKFNPS QEKDGKIDFT INTNGGLRNR VYEVPVETKF. It is sometimes possible for the material contained within the vial of "SLC26A3, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.