Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA23511_WB8.jpg WB (Western Blot) (25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 1 ug/mL of the antibody was used in this experiment. Canonical 70 kDa isoform is identified, and a second isoform of 65 kDa is also present in some samples.)

Rabbit SLC27A2 Polyclonal Antibody | anti-SLC27A2 antibody

SLC27A2 antibody - N-terminal region

Average rating 0.0
No ratings yet
Gene Names
SLC27A2; VLCS; FATP2; VLACS; ACSVL1; FACVL1; hFACVL1; HsT17226
Reactivity
Tested Species Reactivity: Human
Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit
Applications
Immunohistochemistry, Western Blot
Purity
Affinity Purified
Synonyms
SLC27A2, Antibody; SLC27A2 antibody - N-terminal region; anti-SLC27A2 antibody
Ordering
Host
Rabbit
Reactivity
Tested Species Reactivity: Human
Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration
0.5mg/mL (varies by lot)
Sequence
Synthetic peptide located within the following region: LLFRDETLTYAQVDRRSNQVARALHDHLGLRQGDCVALLMGNEPAYVWLW
Sequence Length
620
Applicable Applications for anti-SLC27A2 antibody
IHC (Immunohistochemistry), WB (Western Blot)
Application Notes
IHC Information: Liver, Human: Formalin-Fixed, Paraffin-Embedded (FFPE)
Homology
Cow: 93%; Dog: 93%; Guinea Pig: 92%; Horse: 93%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 93%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human SLC27A2
Protein Size (# AA)
620 amino acids
Protein Interactions
UBC; YWHAQ; SDHA; PEX14; CALR; ABCD1; PEX5; NCSTN;
Enhanced Validation
WB
Y
SPR
YCHAROS
Blocking Peptide
For anti-SLC27A2 (AAA23511) antibody is Catalog #
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 1 ug/mL of the antibody was used in this experiment. Canonical 70 kDa isoform is identified, and a second isoform of 65 kDa is also present in some samples.)

product-image-AAA23511_WB8.jpg WB (Western Blot) (25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 1 ug/mL of the antibody was used in this experiment. Canonical 70 kDa isoform is identified, and a second isoform of 65 kDa is also present in some samples.)

WB (Western Blot)

(WB Suggested Anti-SLC27A2 antibody Titration: 1 ug/mLSample Type: Human PANC1)

product-image-AAA23511_WB7.jpg WB (Western Blot) (WB Suggested Anti-SLC27A2 antibody Titration: 1 ug/mLSample Type: Human PANC1)

WB (Western Blot)

(WB Suggested Anti-SLC27A2 antibody Titration: 1 ug/mLSample Type: Human MCF7)

product-image-AAA23511_WB6.jpg WB (Western Blot) (WB Suggested Anti-SLC27A2 antibody Titration: 1 ug/mLSample Type: Human MCF7)

WB (Western Blot)

(WB Suggested Anti-SLC27A2 Antibody Titration: 1 ug/mlPositive Control: Jurkat lysate)

product-image-AAA23511_WB5.jpg WB (Western Blot) (WB Suggested Anti-SLC27A2 Antibody Titration: 1 ug/mlPositive Control: Jurkat lysate)

WB (Western Blot)

(WB Suggested Anti-SLC27A2 Antibody Titration: 1 ug/mlPositive Control: Hela cell lysate)

product-image-AAA23511_WB4.jpg WB (Western Blot) (WB Suggested Anti-SLC27A2 Antibody Titration: 1 ug/mlPositive Control: Hela cell lysate)

WB (Western Blot)

(Host: RabbitTarget Name: SLC27A2Sample Type: HelaLane A: Primary AntibodyLane B: Primary Antibody + Blocking PeptidePrimary Antibody Concentration: 1ug/mlPeptide Concentration: 5.0 ug/mlLysate Quantity: 25ug/lane/laneGel Concentration: 12%SLC27A2 is strongly supported by BioGPS gene expression data to be expressed in Human HeLa cells)

product-image-AAA23511_WB3.jpg WB (Western Blot) (Host: RabbitTarget Name: SLC27A2Sample Type: HelaLane A: Primary AntibodyLane B: Primary Antibody + Blocking PeptidePrimary Antibody Concentration: 1ug/mlPeptide Concentration: 5.0 ug/mlLysate Quantity: 25ug/lane/laneGel Concentration: 12%SLC27A2 is strongly supported by BioGPS gene expression data to be expressed in Human HeLa cells)

IHC (Immunohistochemistry)

(Liver, Human: Formalin-Fixed, Paraffin-Embedded (FFPE))

product-image-AAA23511_IHC2.jpg IHC (Immunohistochemistry) (Liver, Human: Formalin-Fixed, Paraffin-Embedded (FFPE))

IHC (Immunohistochemistry)

(Liver, Human: Formalin-Fixed, Paraffin-Embedded (FFPE))

product-image-AAA23511_IHC.jpg IHC (Immunohistochemistry) (Liver, Human: Formalin-Fixed, Paraffin-Embedded (FFPE))
Related Product Information for anti-SLC27A2 antibody
This is a rabbit polyclonal antibody against SLC27A2. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: SLC27A2 is an isozyme of long-chain fatty-acid-coenzyme A ligase family. Although differing in substrate specificity, subcellular localization, and tissue distribution, all isozymes of this family convert free long-chain fatty acids into fatty acyl-CoA esters, and thereby play a key role in lipid biosynthesis and fatty acid degradation. This isozyme activates long-chain, branched-chain and very-long-chain fatty acids containing 22 or more carbons to their CoA derivatives. It is expressed primarily in liver and kidney, and is present in both endoplasmic reticulum and peroxisomes, but not in mitochondria. Its decreased peroxisomal enzyme activity is in part responsible for the biochemical pathology in X-linked adrenoleukodystrophy.The protein encoded by this gene is an isozyme of long-chain fatty-acid-coenzyme A ligase family. Although differing in substrate specificity, subcellular localization, and tissue distribution, all isozymes of this family convert free long-chain fatty acids into fatty acyl-CoA esters, and thereby play a key role in lipid biosynthesis and fatty acid degradation. This isozyme activates long-chain, branched-chain and very-long-chain fatty acids containing 22 or more carbons to their CoA derivatives. It is expressed primarily in liver and kidney, and is present in both endoplasmic reticulum and peroxisomes but not in mitochondria. Its decreased peroxisomal enzyme activity is in part responsible for the biochemical pathology in X-linked adrenoleukodystrophy.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
70kDa
NCBI Official Full Name
very long-chain acyl-CoA synthetase isoform 1
NCBI Official Synonym Full Names
solute carrier family 27 member 2
NCBI Official Symbol
SLC27A2
NCBI Official Synonym Symbols
VLCS; FATP2; VLACS; ACSVL1; FACVL1; hFACVL1; HsT17226
NCBI Protein Information
very long-chain acyl-CoA synthetase
UniProt Protein Name
Very long-chain acyl-CoA synthetase
UniProt Gene Name
SLC27A2
UniProt Synonym Gene Names
ACSVL1; FACVL1; FATP2; VLACS; VLACS; VLCS; FATP-2
UniProt Entry Name
S27A2_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The SLC27A2 slc27a2 (Catalog #AAA23511) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The SLC27A2 antibody - N-terminal region reacts with Tested Species Reactivity: Human Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit and may cross-react with other species as described in the data sheet. AAA Biotech's SLC27A2 can be used in a range of immunoassay formats including, but not limited to, IHC (Immunohistochemistry), WB (Western Blot). IHC Information: Liver, Human: Formalin-Fixed, Paraffin-Embedded (FFPE) . Researchers should empirically determine the suitability of the SLC27A2 slc27a2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: LLFRDETLTY AQVDRRSNQV ARALHDHLGL RQGDCVALLM GNEPAYVWLW. It is sometimes possible for the material contained within the vial of "SLC27A2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.