Rabbit SLC34A2 Polyclonal Antibody | anti-SLC34A2 antibody
Anti-SLC34A2 Antibody
Gene Names
SLC34A2; NPTIIb; NAPI-3B; NAPI-IIb
Reactivity
Human, Mouse, Rat
Applications
Flow Cytometry, Functional Assay, Immunocytochemistry, Immunohistochemistry, Western Blot
Purity
Immunogen Affinity Purified
Synonyms
SLC34A2, Antibody; Anti-SLC34A2 Antibody; Sodium-dependent phosphate transport protein 2B; Sodium-phosphate transport protein 2B; Na(+)-dependent phosphate cotransporter 2B; NaPi3b; Sodium/phosphate cotransporter 2B; Na(+)/Pi cotransporter 2B; NaPi-2b; Solute carrier family 34 member 2; SLC34A2; anti-SLC34A2 antibody
Host
Rabbit
Reactivity
Human, Mouse, Rat
Clonality
Polyclonal
Isotype
IgG
Specificity
No cross reactivity with other proteins.
Purity/Purification
Immunogen Affinity Purified
Form/Format
Lyophilized ; Each vial contains 4mg Trehalose, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Sequence Length
689
Applicable Applications for anti-SLC34A2 antibody
FCM/FACS (Flow Cytometry), ICC (Immunocytochemistry), IHC (Immunohistochemistry), WB (Western Blot)
Immunogen
A synthetic peptide corresponding to a sequence of human SLC34A2 (QNWTMKNVTYKENIAKCQHIFVNFHLPDLA).
Reconstitution
0.2ml of distilled water will yield a concentration of 500mug/ml.
Relevant Detection Systems
MBS recommends Enhanced Chemiluminescent Kit with anti-Rabbit IgG for Western blot, and HRP Conjugated anti-Rabbit IgG Super Vision Assay Kit for IHC(P), IHC(F) and ICC.
Preparation and Storage
Store at -20°C for one year from date of receipt. After reconstitution, store at 4°C for one month. It can also be aliquotted and stored frozen at -20°C for six months.
Avoid repeated freezing and thawing.
Avoid repeated freezing and thawing.
Related Product Information for anti-SLC34A2 antibody
Background: Sodium-dependent phosphate transport protein 2B (NaPi2b) is a protein that in humans is encoded by the SLC34A2 gene. The protein encoded by this gene is a pH-sensitive sodium-dependent phosphate transporter. Phosphate uptake is increased at lower pH. Defects in this gene are a cause of pulmonary alveolar microlithiasis. Three transcript variants encoding two different isoforms have been found for this gene.
References
1. Corut, A., Senyigit, A., Ugur, S. A., Altin, S., Ozcelik, U., Calisir, H., Yildirim, Z., Gocmen, A., Tolun, A. Mutations in SLC34A2 cause pulmonary alveolar microlithiasis and are possibly associated with testicular microlithiasis. Am. J. Hum. Genet. 79: 650-656, 2006. 2. Feild, J. A., Zhang, L., Brun, K. A., Brooks, D. P., Edwards, R. M. Cloning and functional characterization of a sodium-dependent phosphate transporter expressed in human lung and small intestine. Biochem. Biophys. Res. Commun. 258: 578-582, 1999.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
NCBI Official Full Name
sodium-dependent phosphate transport protein 2B isoform b
NCBI Official Synonym Full Names
solute carrier family 34 member 2
NCBI Official Symbol
SLC34A2
NCBI Official Synonym Symbols
NPTIIb; NAPI-3B; NAPI-IIb
NCBI Protein Information
sodium-dependent phosphate transport protein 2B
UniProt Protein Name
Sodium-dependent phosphate transport protein 2B
UniProt Gene Name
SLC34A2
UniProt Synonym Gene Names
Sodium-phosphate transport protein 2B; Na(+)/Pi cotransporter 2B; NaPi-2b
Similar Products
Product Notes
The SLC34A2 slc34a2 (Catalog #AAA124955) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Anti-SLC34A2 Antibody reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's SLC34A2 can be used in a range of immunoassay formats including, but not limited to, FCM/FACS (Flow Cytometry), ICC (Immunocytochemistry), IHC (Immunohistochemistry), WB (Western Blot). Researchers should empirically determine the suitability of the SLC34A2 slc34a2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "SLC34A2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.