Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA197510_WB8.jpg WB (Western Blot) (25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/mL of the antibody was used in this experiment. Protein has two closely sized isoforms and can be glycosylated.)

Rabbit SLC38A2 Polyclonal Antibody | anti-SLC38A2 antibody

SLC38A2 antibody - N-terminal region

Gene Names
SLC38A2; ATA2; SAT2; SNAT2; PRO1068
Reactivity
Tested Reactivity: Human
Predicted Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit
Applications
Western Blot
Purity
Affinity Purified
Synonyms
SLC38A2, Antibody; SLC38A2 antibody - N-terminal region; anti-SLC38A2 antibody
Ordering
Host
Rabbit
Reactivity
Tested Reactivity: Human
Predicted Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration
0.5 mg/mL (varies by lot)
Sequence
AALKSHYADVDPENQNFLLESNLGKKKYETEFHPGTTSFGMSVFNLSNAI
Applicable Applications for anti-SLC38A2 antibody
WB (Western Blot)
Protein Size (# AA)
506 amino acids
Protein Interactions
UBC; APP; MCU; FLOT1; COX5A; ELAVL1; STX11;
Blocking Peptide
For anti-SLC38A2 (MBS3201302) antibody is Catalog # MBS3226325
Predicted Homology
Cow: 93%; Dog: 93%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 93%; Pig: 100%; Rabbit: 93%; Rat: 93%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human SLC38A2
Replacement Item
This antibody may replace item sc-166366 from Santa Cruz Biotechnology.
Preparation and Storage
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/mL of the antibody was used in this experiment. Protein has two closely sized isoforms and can be glycosylated.)

product-image-AAA197510_WB8.jpg WB (Western Blot) (25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/mL of the antibody was used in this experiment. Protein has two closely sized isoforms and can be glycosylated.)

WB (Western Blot)

(WB Suggested Anti-SLC38A2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: HT1080 cell lysateSLC38A2 is strongly supported by BioGPS gene expression data to be expressed in Human HT1080 cells)

product-image-AAA197510_WB10.jpg WB (Western Blot) (WB Suggested Anti-SLC38A2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: HT1080 cell lysateSLC38A2 is strongly supported by BioGPS gene expression data to be expressed in Human HT1080 cells)

WB (Western Blot)

(Host: RabbitTarget Name: SLC38A2Sample Tissue: Human THP-1 Whole CellAntibody Dilution: 1ug/ml)

product-image-AAA197510_WB11.jpg WB (Western Blot) (Host: RabbitTarget Name: SLC38A2Sample Tissue: Human THP-1 Whole CellAntibody Dilution: 1ug/ml)

WB (Western Blot)

(Host: RabbitTarget Name: SLC38A2Sample Tissue: Human OVCAR-3 Whole CellAntibody Dilution: 1ug/ml)

product-image-AAA197510_WB13.jpg WB (Western Blot) (Host: RabbitTarget Name: SLC38A2Sample Tissue: Human OVCAR-3 Whole CellAntibody Dilution: 1ug/ml)

WB (Western Blot)

(Host: RabbitTarget Name: SLC38A2Sample Tissue: Human HepG2Antibody Dilution: 1.0ug/ml)

product-image-AAA197510_WB15.jpg WB (Western Blot) (Host: RabbitTarget Name: SLC38A2Sample Tissue: Human HepG2Antibody Dilution: 1.0ug/ml)
Related Product Information for anti-SLC38A2 antibody
This is a rabbit polyclonal antibody against SLC38A2. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: Under hypertonic conditions the induction of SLC38A2/SNAT2 leads to the stimulation of transport system A and to the increase in the cell content of amino acids. Its amino acid response element, along with a nearby conserved CAAT box, has enhancer activity in that it functions in an orientation and position independent manner, and it confers regulated transcription to a heterologous promoter.
Product Categories/Family for anti-SLC38A2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
56kDa
NCBI Official Full Name
sodium-coupled neutral amino acid transporter 2 isoform 1
NCBI Official Synonym Full Names
solute carrier family 38 member 2
NCBI Official Symbol
SLC38A2
NCBI Official Synonym Symbols
ATA2; SAT2; SNAT2; PRO1068
NCBI Protein Information
sodium-coupled neutral amino acid transporter 2
UniProt Protein Name
Sodium-coupled neutral amino acid transporter 2
UniProt Gene Name
SLC38A2
UniProt Synonym Gene Names
ATA2; KIAA1382; SAT2; SNAT2
UniProt Entry Name
S38A2_HUMAN

Similar Products

Product Notes

The SLC38A2 slc38a2 (Catalog #AAA197510) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The SLC38A2 antibody - N-terminal region reacts with Tested Reactivity: Human Predicted Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit and may cross-react with other species as described in the data sheet. AAA Biotech's SLC38A2 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the SLC38A2 slc38a2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: AALKSHYADV DPENQNFLLE SNLGKKKYET EFHPGTTSFG MSVFNLSNAI. It is sometimes possible for the material contained within the vial of "SLC38A2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.