Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA199367_WB13.jpg WB (Western Blot) (WB Suggested Anti-SLC39A8 Antibody Titration: 0.2-1 ug/mlPositive Control: NCI-H226 cell lysateThere is BioGPS gene expression data showing that SLC39A8 is expressed in NCIH226)

Rabbit SLC39A8 Polyclonal Antibody | anti-SLC39A8 antibody

SLC39A8 antibody - N-terminal region

Average rating 0.0
No ratings yet
Gene Names
SLC39A8; ZIP8; CDG2N; PP3105; BIGM103; LZT-Hs6
Reactivity
Dog, Horse, Human, Pig
Applications
Western Blot, Immunohistochemistry
Purity
Affinity Purified
Synonyms
SLC39A8, Antibody; SLC39A8 antibody - N-terminal region; anti-SLC39A8 antibody
Ordering
Host
Rabbit
Reactivity
Dog, Horse, Human, Pig
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: QLNFHPCEDRPKHKTRPSHSEVWGYGFLSVTIINLASLLGLILTPLIKKS
Sequence Length
460
Applicable Applications for anti-SLC39A8 antibody
WB (Western Blot), IHC (Immunohistochemistry)
Homology
Dog: 79%; Horse: 79%; Human: 100%; Pig: 85%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human SLC39A8
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-SLC39A8 Antibody Titration: 0.2-1 ug/mlPositive Control: NCI-H226 cell lysateThere is BioGPS gene expression data showing that SLC39A8 is expressed in NCIH226)

product-image-AAA199367_WB13.jpg WB (Western Blot) (WB Suggested Anti-SLC39A8 Antibody Titration: 0.2-1 ug/mlPositive Control: NCI-H226 cell lysateThere is BioGPS gene expression data showing that SLC39A8 is expressed in NCIH226)

IHC (Immunohistochemistry)

(Sample Type :Human Pancreas (Cancer) & rat pancreas Primary Antibody Dilution :1:150Secondary Antibody :Goat anti-RabbitSecondary Antibody Dilution :1:300Gene Name :SLC39A8Submitted by :Anonymous)

product-image-AAA199367_IHC15.jpg IHC (Immunohistochemistry) (Sample Type :Human Pancreas (Cancer) & rat pancreas Primary Antibody Dilution :1:150Secondary Antibody :Goat anti-RabbitSecondary Antibody Dilution :1:300Gene Name :SLC39A8Submitted by :Anonymous)
Related Product Information for anti-SLC39A8 antibody
This is a rabbit polyclonal antibody against SLC39A8. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: This gene encodes a member of the SLC39 family of solute-carrier genes, which show structural characteristics of zinc transporters. The encoded protein is glycosylated and found in the plasma membrane and mitochondria, and functions in the cellular import
Product Categories/Family for anti-SLC39A8 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
50kDa
NCBI Official Full Name
zinc transporter ZIP8 isoform a
NCBI Official Synonym Full Names
solute carrier family 39 member 8
NCBI Official Symbol
SLC39A8
NCBI Official Synonym Symbols
ZIP8; CDG2N; PP3105; BIGM103; LZT-Hs6
NCBI Protein Information
zinc transporter ZIP8
UniProt Protein Name
Zinc transporter ZIP8
UniProt Gene Name
SLC39A8
UniProt Synonym Gene Names
BIGM103; ZIP8; LZT-Hs6; ZIP-8
UniProt Entry Name
S39A8_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The SLC39A8 slc39a8 (Catalog #AAA199367) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The SLC39A8 antibody - N-terminal region reacts with Dog, Horse, Human, Pig and may cross-react with other species as described in the data sheet. AAA Biotech's SLC39A8 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot), IHC (Immunohistochemistry). Researchers should empirically determine the suitability of the SLC39A8 slc39a8 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: QLNFHPCEDR PKHKTRPSHS EVWGYGFLSV TIINLASLLG LILTPLIKKS. It is sometimes possible for the material contained within the vial of "SLC39A8, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.