Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA224424_WB13.jpg WB (Western Blot) (SLC6A18 antibody (AAA224424) used at 1.25 ug/ml to detect target protein.)

Rabbit SLC6A18 Polyclonal Antibody | anti-SLC6A18 antibody

SLC6A18 antibody

Average rating 0.0
No ratings yet
Reactivity
Human, Mouse, Rat
Applications
Immunohistochemistry, Western Blot
Purity
Total IgG Protein A purified
Synonyms
SLC6A18, Antibody; SLC6A18 antibody; Polyclonal SLC6A18; Anti-SLC6A18; Solute Carrier Family 6 Member 18; FLJ31236; SLCA18-6; Xtrp2; SLCA18 6; SLC6A18; anti-SLC6A18 antibody
Ordering
Host
Rabbit
Reactivity
Human, Mouse, Rat
Clonality
Polyclonal
Specificity
SLC6A18 antibody was raised against the middle region of SLC6A18
Purity/Purification
Total IgG Protein A purified
Form/Format
Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of SLC6A18 antibody in PBS
Concentration
1 mg/ml (varies by lot)
Applicable Applications for anti-SLC6A18 antibody
IHC (Immunohistochemistry), WB (Western Blot)
Biological Significance
The SLC6 family of proteins, which includes SLC6A18, acts as specific transporters for neurotransmitters, amino acids, and osmolytes like betaine, taurine, and creatine. SLC6 proteins are sodium cotransporters that derive the energy for solute transport from the electrochemical gradient for sodium ions.
Cross-Reactivity
Human,Mouse,Rat
Immunogen
SLC6A18 antibody was raised using the middle region of SLC6A18 corresponding to a region with amino acids MHLNATWPKRVAQLPLKACLLEDFLDKSASGPGLAFVVFTETDLHMPGAP
Preparation and Storage
Store at 2-8 degree C for short periods. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.

WB (Western Blot)

(SLC6A18 antibody (AAA224424) used at 1.25 ug/ml to detect target protein.)

product-image-AAA224424_WB13.jpg WB (Western Blot) (SLC6A18 antibody (AAA224424) used at 1.25 ug/ml to detect target protein.)

IHC (Immunohistochemistry)

(SLC6A18 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Epithelial cells of renal tubule (arrows) in Human Kidney. Magnification is at 400X)

product-image-AAA224424_IHC15.jpg IHC (Immunohistochemistry) (SLC6A18 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Epithelial cells of renal tubule (arrows) in Human Kidney. Magnification is at 400X)
Related Product Information for anti-SLC6A18 antibody
Rabbit polyclonal SLC6A18 antibody raised against the middle region of SLC6A18
Product Categories/Family for anti-SLC6A18 antibody

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The SLC6A18 (Catalog #AAA224424) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The SLC6A18 antibody reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's SLC6A18 can be used in a range of immunoassay formats including, but not limited to, IHC (Immunohistochemistry), WB (Western Blot). Researchers should empirically determine the suitability of the SLC6A18 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "SLC6A18, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.