Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA199338_WB11.jpg WB (Western Blot) (WB Suggested Anti-SLC6A5 antibody Titration: 1 ug/mLSample Type: Human heart)

Rabbit SLC6A5 Polyclonal Antibody | anti-SLC6A5 antibody

SLC6A5 Antibody - N-terminal region

Gene Names
SLC6A5; NET1; GLYT2; HKPX3; GLYT-2
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Immunohistochemistry, Western Blot
Purity
Affinity Purified
Synonyms
SLC6A5, Antibody; SLC6A5 Antibody - N-terminal region; anti-SLC6A5 antibody
Ordering
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: KNSTFCMTAYPNVTMVNFTSQANKTFVSGSEEYFKYFVLKISAGIEYPGE
Sequence Length
395
Applicable Applications for anti-SLC6A5 antibody
IHC (Immunohistochemistry), WB (Western Blot)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 85%
Immunogen
The immunogen is a synthetic peptide directed towards the N-terminal region of human SLC6A5
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-SLC6A5 antibody Titration: 1 ug/mLSample Type: Human heart)

product-image-AAA199338_WB11.jpg WB (Western Blot) (WB Suggested Anti-SLC6A5 antibody Titration: 1 ug/mLSample Type: Human heart)

WB (Western Blot)

(Host: RabbitTarget Name: SLC6A5Sample Type: COLO205 Whole cell lysatesAntibody Dilution: 1.0ug/ml)

product-image-AAA199338_WB13.jpg WB (Western Blot) (Host: RabbitTarget Name: SLC6A5Sample Type: COLO205 Whole cell lysatesAntibody Dilution: 1.0ug/ml)

IHC (Immunohistochemistry)

(Rabbit Anti-SLC6A5 AntibodyFormalin Fixed Paraffin Embedded Tissue: Human Adult heartObserved Staining: CytoplasmicPrimary Antibody Concentration: 1:600Secondary Antibody: Donkey anti-Rabbit-Cy2/3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 secProtocol located in Reviews and Data.)

product-image-AAA199338_IHC15.jpg IHC (Immunohistochemistry) (Rabbit Anti-SLC6A5 AntibodyFormalin Fixed Paraffin Embedded Tissue: Human Adult heartObserved Staining: CytoplasmicPrimary Antibody Concentration: 1:600Secondary Antibody: Donkey anti-Rabbit-Cy2/3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 secProtocol located in Reviews and Data.)
Related Product Information for anti-SLC6A5 antibody
This is a rabbit polyclonal antibody against SLC6A5. It was validated on Western Blot

Target Description: This gene encodes a sodium- and chloride-dependent glycine neurotransmitter transporter. This integral membrane glycoprotein is responsible for the clearance of extracellular glycine during glycine-mediated neurotransmission. This protein is found in glycinergic axons and maintains a high presynaptic pool of neurotransmitter at glycinergic synapses. Mutations in this gene cause hyperekplexia; a heterogenous neurological disorder characterized by exaggerated startle responses and neonatal apnea. Two transcript variants encoding different isoforms have been found for this gene.
Product Categories/Family for anti-SLC6A5 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
43kDa
NCBI Official Full Name
sodium- and chloride-dependent glycine transporter 2
NCBI Official Synonym Full Names
solute carrier family 6 member 5
NCBI Official Symbol
SLC6A5
NCBI Official Synonym Symbols
NET1; GLYT2; HKPX3; GLYT-2
NCBI Protein Information
sodium- and chloride-dependent glycine transporter 2
UniProt Protein Name
Sodium- and chloride-dependent glycine transporter 2
UniProt Gene Name
SLC6A5
UniProt Synonym Gene Names
GLYT2; NET1; GlyT-2; GlyT2
UniProt Entry Name
SC6A5_HUMAN

Similar Products

Product Notes

The SLC6A5 slc6a5 (Catalog #AAA199338) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The SLC6A5 Antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's SLC6A5 can be used in a range of immunoassay formats including, but not limited to, IHC (Immunohistochemistry), WB (Western Blot). Researchers should empirically determine the suitability of the SLC6A5 slc6a5 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: KNSTFCMTAY PNVTMVNFTS QANKTFVSGS EEYFKYFVLK ISAGIEYPGE. It is sometimes possible for the material contained within the vial of "SLC6A5, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.