Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA199313_WB15.jpg WB (Western Blot) (WB Suggested Anti-Slc7a3 AntibodyTitration: 1.0 ug/mlPositive Control: Mouse Spleen)

Rabbit Slc7a3 Polyclonal Antibody | anti-SLC7A3 antibody

Slc7a3 antibody - middle region

Average rating 0.0
No ratings yet
Gene Names
Slc7a3; CAT3; Atrc3; CAT-3; SLC7A1; SLC7A2
Reactivity
Tested Reactivity:Mouse
Predicted Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
Applications
Western Blot
Purity
Affinity Purified
Synonyms
Slc7a3, Antibody; Slc7a3 antibody - middle region; anti-SLC7A3 antibody
Ordering
Host
Rabbit
Reactivity
Tested Reactivity:Mouse
Predicted Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml (varies by lot)
Sequence
RAWSSAFDNLIGNHISRTLKGTILLKMPHVLAEYPDFFALALVLLLTGLL
Applicable Applications for anti-SLC7A3 antibody
WB (Western Blot)
Protein Size (# AA)
618 amino acids
Blocking Peptide
For anti-Slc7a3 (MBS3207037) antibody is Catalog # MBS3232003
Immunogen
The immunogen is a synthetic peptide corresponding to a region of Mouse
Predicted Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Replacement Item
This antibody may replace item sc-142026 from Santa Cruz Biotechnology.
Preparation and Storage
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-Slc7a3 AntibodyTitration: 1.0 ug/mlPositive Control: Mouse Spleen)

product-image-AAA199313_WB15.jpg WB (Western Blot) (WB Suggested Anti-Slc7a3 AntibodyTitration: 1.0 ug/mlPositive Control: Mouse Spleen)
Related Product Information for anti-SLC7A3 antibody
Slc7a3 mediates the uptake of the cationic amino acids arginine, lysine and ornithine in a sodium-independent manner.
Product Categories/Family for anti-SLC7A3 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
67kDa
NCBI Official Full Name
cationic amino acid transporter 3
NCBI Official Synonym Full Names
solute carrier family 7 (cationic amino acid transporter, y+ system), member 3
NCBI Official Symbol
Slc7a3
NCBI Official Synonym Symbols
CAT3; Atrc3; CAT-3; SLC7A1; SLC7A2
NCBI Protein Information
cationic amino acid transporter 3
UniProt Protein Name
Cationic amino acid transporter 3
UniProt Gene Name
Slc7a3
UniProt Synonym Gene Names
Atrc3; Cat3; CAT-3; CAT3
UniProt Entry Name
CTR3_MOUSE

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The SLC7A3 slc7a3 (Catalog #AAA199313) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Slc7a3 antibody - middle region reacts with Tested Reactivity:Mouse Predicted Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit and may cross-react with other species as described in the data sheet. AAA Biotech's Slc7a3 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the SLC7A3 slc7a3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: RAWSSAFDNL IGNHISRTLK GTILLKMPHV LAEYPDFFAL ALVLLLTGLL. It is sometimes possible for the material contained within the vial of "Slc7a3, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.