Rabbit SLX1B Polyclonal Antibody | anti-SLX1B antibody
SLX1B Antibody - N-terminal region
Gene Names
SLX1A; GIYD1
Reactivity
Tested: HumanPredicted: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
Applications
Western Blot
Purity
Affinity Purified
Synonyms
SLX1B, Antibody; SLX1B Antibody - N-terminal region; anti-SLX1B antibody
Host
Rabbit
Reactivity
Tested: Human
Predicted: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
Predicted: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: FFGVYLLYCLNPRYRGRVYVGFTVNTARRVQQHNGGRKKGGAWRTSGRGP
Sequence Length
275
Applicable Applications for anti-SLX1B antibody
WB (Western Blot)
Protein Size (# AA)
275 amino acids
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 86%; Rabbit: 86%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N-terminal region of Human SLX1B
Blocking Peptide
For anti-SLX1B (MBS3218936) antibody is Catalog #
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Related Product Information for anti-SLX1B antibody
This is a rabbit polyclonal antibody against SLX1B. It was validated on Western Blot
Target Description: This gene encodes a protein that is an important regulator of genome stability. The protein represents the catalytic subunit of the SLX1-SLX4 structure-specific endonuclease, which can resolve DNA secondary structures that are formed during repair and recombination processes. Two identical copies of this gene are located on the p arm of chromosome 16 due to a segmental duplication; this record represents the more telomeric copy. Alternative splicing results in multiple transcript variants. Read-through transcription also occurs between this gene and the downstream SULT1A4 (sulfotransferase family, cytosolic, 1A, phenol-preferring, member 4) gene.
Target Description: This gene encodes a protein that is an important regulator of genome stability. The protein represents the catalytic subunit of the SLX1-SLX4 structure-specific endonuclease, which can resolve DNA secondary structures that are formed during repair and recombination processes. Two identical copies of this gene are located on the p arm of chromosome 16 due to a segmental duplication; this record represents the more telomeric copy. Alternative splicing results in multiple transcript variants. Read-through transcription also occurs between this gene and the downstream SULT1A4 (sulfotransferase family, cytosolic, 1A, phenol-preferring, member 4) gene.
Product Categories/Family for anti-SLX1B antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
30kDa
NCBI Official Full Name
structure-specific endonuclease subunit SLX1 isoform 1
NCBI Official Synonym Full Names
SLX1 homolog A, structure-specific endonuclease subunit
NCBI Official Symbol
SLX1A
NCBI Official Synonym Symbols
GIYD1
NCBI Protein Information
structure-specific endonuclease subunit SLX1
UniProt Protein Name
Structure-specific endonuclease subunit SLX1
UniProt Gene Name
SLX1A
UniProt Synonym Gene Names
GIYD1; SLX1
SLX1B; GIYD2; SLX1
SLX1B; GIYD2; SLX1
UniProt Entry Name
SLX1_HUMAN
Customer Reviews
Loading reviews...
Share Your Experience
Similar Products
Product Notes
The SLX1B slx1a (Catalog #AAA201467) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The SLX1B Antibody - N-terminal region reacts with Tested: Human Predicted: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit and may cross-react with other species as described in the data sheet. AAA Biotech's SLX1B can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the SLX1B slx1a for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: FFGVYLLYCL NPRYRGRVYV GFTVNTARRV QQHNGGRKKG GAWRTSGRGP. It is sometimes possible for the material contained within the vial of "SLX1B, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
