<
WB (Western Blot)
(WB Suggested Anti-SMAD3 Antibody Titration: 2.0ug/mlPositive Control: Human Liver)
Rabbit SMAD3 Polyclonal Antibody | anti-SMAD3 antibody
SMAD3 antibody - N-terminal region
Gene Names
SMAD3; LDS3; LDS1C; MADH3; JV15-2; HSPC193; HsT17436
Reactivity
Dog, Guinea Pig, Human, Mouse, Rat, Zebrafish
Applications
Western Blot, Immunohistochemistry
Purity
Protein A purified
Synonyms
SMAD3, Antibody; SMAD3 antibody - N-terminal region; anti-SMAD3 antibody
Host
Rabbit
Reactivity
Dog, Guinea Pig, Human, Mouse, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Protein A purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: FTPPIVKRLLGWKKGEQNGQEEKWCEKAVKSLVKKLKKTGQLDELEKAIT
Sequence Length
425
Applicable Applications for anti-SMAD3 antibody
WB (Western Blot), IHC (Immunohistochemistry)
Homology
Dog: 100%; Guinea Pig: 100%; Human: 100%; Mouse: 100%; Rat: 100%; Zebrafish: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human SMAD3
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
WB (Western Blot)
(WB Suggested Anti-SMAD3 Antibody Titration: 2.0ug/mlPositive Control: Human Liver)
WB (Western Blot)
(WB Suggested Anti-SMAD3 Antibody Titration: 2.0ug/mlPositive Control: Human Liver)
WB (Western Blot)
(Host: MouseTarget Name: SMAD3Sample Tissue: Mouse TestisAntibody Dilution: 1ug/ml)
WB (Western Blot)
(Host: MouseTarget Name: SMAD3Sample Tissue: Mouse TestisAntibody Dilution: 1ug/ml)
IHC (Immunohiostchemistry)
(Rabbit Anti-SMAD3 AntibodyFormalin Fixed Paraffin Embedded Tissue: Human Urinary Bladder TissueObserved Staining: CytoplasmPrimary Antibody Concentration: 1:100Other Working Concentrations: N/ASecondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)
IHC (Immunohiostchemistry)
(Rabbit Anti-SMAD3 AntibodyFormalin Fixed Paraffin Embedded Tissue: Human Urinary Bladder TissueObserved Staining: CytoplasmPrimary Antibody Concentration: 1:100Other Working Concentrations: N/ASecondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)
IHC (Immunohistochemistry)
(Human Pancrease)
IHC (Immunohistochemistry)
(Human Pancrease)
Related Product Information for anti-SMAD3 antibody
This is a rabbit polyclonal antibody against SMAD3. It was validated on Western Blot and immunohistochemistry
Target Description: SMAD3 is a member of Smad family proteins. SMAD family is known to be important cytoplasmic mediators of signals from the transforming growth factor-beta (TGF-beta) receptor serine/threonine kinases.
Target Description: SMAD3 is a member of Smad family proteins. SMAD family is known to be important cytoplasmic mediators of signals from the transforming growth factor-beta (TGF-beta) receptor serine/threonine kinases.
Product Categories/Family for anti-SMAD3 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
48kDa
NCBI Official Full Name
mothers against decapentaplegic homolog 3 isoform 1
NCBI Official Synonym Full Names
SMAD family member 3
NCBI Official Symbol
SMAD3
NCBI Official Synonym Symbols
LDS3; LDS1C; MADH3; JV15-2; HSPC193; HsT17436
NCBI Protein Information
mothers against decapentaplegic homolog 3
UniProt Protein Name
Mothers against decapentaplegic homolog 3
UniProt Gene Name
SMAD3
UniProt Synonym Gene Names
MADH3; MAD homolog 3; Mad3; Mothers against DPP homolog 3; hMAD-3; SMAD 3; Smad3; hSMAD3
UniProt Entry Name
SMAD3_HUMAN
Similar Products
Product Notes
The SMAD3 smad3 (Catalog #AAA201736) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The SMAD3 antibody - N-terminal region reacts with Dog, Guinea Pig, Human, Mouse, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's SMAD3 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot), IHC (Immunohistochemistry). Researchers should empirically determine the suitability of the SMAD3 smad3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: FTPPIVKRLL GWKKGEQNGQ EEKWCEKAVK SLVKKLKKTG QLDELEKAIT. It is sometimes possible for the material contained within the vial of "SMAD3, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.