Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA282200_WB13.jpg WB (Western Blot) (Western blot analysis of extracts from wild type(WT) and Smad4 Rabbit pAb knockdown (KD) 293T cells, using Smad4 Rabbit pAb antibody at 1:615 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 30s.)

Rabbit anti-Human Smad4 Polyclonal Antibody | anti-Smad4 antibody

[KD Validated] Smad4 Rabbit pAb

Gene Names
DEFA5; DEF5; HD-5
Reactivity
Human
Applications
Western Blot
Purity
Affinity purification
Synonyms
Smad4, Antibody; [KD Validated] Smad4 Rabbit pAb; SMAD4; DPC4; JIP; MADH4; MYHRS; SMAD family member 4; anti-Smad4 antibody
Ordering
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity purification
Form/Format
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Sequence
ESLQERADEATTQKQSGEDNQDLAISFAGNGLSALRTSGSQARATCYCRTGRCATRESLSGVCEISGRLYRLCCR
Applicable Applications for anti-Smad4 antibody
WB (Western Blot)
Positive Samples
293T, HCT116
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 160-450 of human Smad4 (NP_005350.1).
Cellular Location
Cytoplasm, Nucleus
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.

WB (Western Blot)

(Western blot analysis of extracts from wild type(WT) and Smad4 Rabbit pAb knockdown (KD) 293T cells, using Smad4 Rabbit pAb antibody at 1:615 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 30s.)

product-image-AAA282200_WB13.jpg WB (Western Blot) (Western blot analysis of extracts from wild type(WT) and Smad4 Rabbit pAb knockdown (KD) 293T cells, using Smad4 Rabbit pAb antibody at 1:615 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 30s.)

WB (Western Blot)

(Western blot analysis of HCT116, using Smad4 Rabbit pAb antibody at 1:615 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 30s.)

product-image-AAA282200_WB15.jpg WB (Western Blot) (Western blot analysis of HCT116, using Smad4 Rabbit pAb antibody at 1:615 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 30s.)
Related Product Information for anti-Smad4 antibody
This gene encodes a member of the Smad family of signal transduction proteins. Smad proteins are phosphorylated and activated by transmembrane serine-threonine receptor kinases in response to TGF-beta signaling. The product of this gene forms homomeric complexes and heteromeric complexes with other activated Smad proteins, which then accumulate in the nucleus and regulate the transcription of target genes. This protein binds to DNA and recognizes an 8-bp palindromic sequence (GTCTAGAC) called the Smad-binding element (SBE). The Smad proteins are subject to complex regulation by post-translational modifications. Mutations or deletions in this gene have been shown to result in pancreatic cancer, juvenile polyposis syndrome, and hereditary hemorrhagic telangiectasia syndrome.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
10,071 Da
NCBI Official Full Name
defensin-5 preproprotein
NCBI Official Synonym Full Names
defensin, alpha 5, Paneth cell-specific
NCBI Official Symbol
DEFA5
NCBI Official Synonym Symbols
DEF5; HD-5
NCBI Protein Information
defensin-5; HD5(20-94); defensin 5; defensin, alpha 5, preproprotein
UniProt Protein Name
Defensin-5
UniProt Gene Name
DEFA5
UniProt Synonym Gene Names
DEF5
UniProt Entry Name
DEF5_HUMAN

Similar Products

Product Notes

The Smad4 defa5 (Catalog #AAA282200) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The [KD Validated] Smad4 Rabbit pAb reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's Smad4 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the Smad4 defa5 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: ESLQERADEA TTQKQSGEDN QDLAISFAGN GLSALRTSGS QARATCYCRT GRCATRESLS GVCEISGRLY RLCCR. It is sometimes possible for the material contained within the vial of "Smad4, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.