Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA197271_WB11.jpg WB (Western Blot) (WB Suggested Anti-SMAD5 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: HepG2 cell lysate)

Rabbit SMAD5 Polyclonal Antibody | anti-SMAD5 antibody

SMAD5 antibody - middle region

Gene Names
SMAD5; DWFC; JV5-1; MADH5
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
SMAD5, Antibody; SMAD5 antibody - middle region; anti-SMAD5 antibody
Ordering
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: YPPSPASSTYPNSPASSGPGSPFQLPADTPPPAYMPPDDQMGQDNSQPMD
Sequence Length
465
Applicable Applications for anti-SMAD5 antibody
WB (Western Blot)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Sheep: 93%; Zebrafish: 93%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human SMAD5
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-SMAD5 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: HepG2 cell lysate)

product-image-AAA197271_WB11.jpg WB (Western Blot) (WB Suggested Anti-SMAD5 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: HepG2 cell lysate)

WB (Western Blot)

(Lanes:Lane 1: 5ug of transfected 293T lysate (SMAD1)Lane 1: 5ug of transfected 293T lysate (SMAD2)Lane 1: 5ug of transfected 293T lysate (SMAD3)Lane 1: 5ug of transfected 293T lysate (SMAD4)Lane 1: 5ug of transfected 293T lysate (SMAD5)Lane 1: 5ug of transfected 293T lysate (SMAD6)Lane 1: 5ug of transfected 293T lysate (SMAD7)Lane 1: 5ug of transfected 293T lysate (SMAD8)Lane 1: 5ug of transfected 293T lysate (GFP)Primary Antibody Dilution:1:1000Secondary Antibody:Goat anti-Rabbit IgG HRP ConjugatedSecondary Antibody Dilution:1:10,000Gene Name:SMAD5Submitted by:Amanda Urick, Medical College of Wisconsin)

product-image-AAA197271_WB13.jpg WB (Western Blot) (Lanes:Lane 1: 5ug of transfected 293T lysate (SMAD1)Lane 1: 5ug of transfected 293T lysate (SMAD2)Lane 1: 5ug of transfected 293T lysate (SMAD3)Lane 1: 5ug of transfected 293T lysate (SMAD4)Lane 1: 5ug of transfected 293T lysate (SMAD5)Lane 1: 5ug of transfected 293T lysate (SMAD6)Lane 1: 5ug of transfected 293T lysate (SMAD7)Lane 1: 5ug of transfected 293T lysate (SMAD8)Lane 1: 5ug of transfected 293T lysate (GFP)Primary Antibody Dilution:1:1000Secondary Antibody:Goat anti-Rabbit IgG HRP ConjugatedSecondary Antibody Dilution:1:10,000Gene Name:SMAD5Submitted by:Amanda Urick, Medical College of Wisconsin)

WB (Western Blot)

(Host: RatTarget Name: SMAD5Sample Tissue: Rat LiverAntibody Dilution: 1ug/ml)

product-image-AAA197271_WB15.jpg WB (Western Blot) (Host: RatTarget Name: SMAD5Sample Tissue: Rat LiverAntibody Dilution: 1ug/ml)
Related Product Information for anti-SMAD5 antibody
This is a rabbit polyclonal antibody against SMAD5. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: SMAD5 undergoes copy number gain and increased expression, rather than loss of expression, and therefore does not act as a tumor-suppressor gene in hepatocellular carcinoma. Up-regulated Smad5 mediates apoptosis of gastric epithelial cells induced by Helicobacter pylori infection.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
51kDa
NCBI Official Full Name
mothers against decapentaplegic homolog 5
NCBI Official Synonym Full Names
SMAD family member 5
NCBI Official Symbol
SMAD5
NCBI Official Synonym Symbols
DWFC; JV5-1; MADH5
NCBI Protein Information
mothers against decapentaplegic homolog 5
UniProt Protein Name
Mothers against decapentaplegic homolog 5
UniProt Gene Name
SMAD5
UniProt Synonym Gene Names
MADH5; MAD homolog 5; Mothers against DPP homolog 5; SMAD 5; Smad5; hSmad5
UniProt Entry Name
SMAD5_HUMAN

Similar Products

Product Notes

The SMAD5 smad5 (Catalog #AAA197271) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The SMAD5 antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's SMAD5 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the SMAD5 smad5 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: YPPSPASSTY PNSPASSGPG SPFQLPADTP PPAYMPPDDQ MGQDNSQPMD. It is sometimes possible for the material contained within the vial of "SMAD5, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.