Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA198269_WB8.jpg WB (Western Blot) (WB Suggested Anti-SMARCE1 Antibody Titration: 0.2-1 ug/mlPositive Control: Jurkat cell lysateSMARCE1 is strongly supported by BioGPS gene expression data to be expressed in Human Jurkat cells)

Rabbit SMARCE1 Polyclonal Antibody | anti-SMARCE1 antibody

SMARCE1 antibody - N-terminal region

Average rating 0.0
No ratings yet
Gene Names
SMARCE1; CSS5; BAF57
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Western Blot, Immunohistochemistry
Purity
Affinity Purified
Synonyms
SMARCE1, Antibody; SMARCE1 antibody - N-terminal region; anti-SMARCE1 antibody
Ordering
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: MSKRPSYAPPPTPAPATQMPSTPGFVGYNPYSHLAYNNYRLGGNPGTNSR
Sequence Length
411
Applicable Applications for anti-SMARCE1 antibody
WB (Western Blot), IHC (Immunohistochemistry)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human SMARCE1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-SMARCE1 Antibody Titration: 0.2-1 ug/mlPositive Control: Jurkat cell lysateSMARCE1 is strongly supported by BioGPS gene expression data to be expressed in Human Jurkat cells)

product-image-AAA198269_WB8.jpg WB (Western Blot) (WB Suggested Anti-SMARCE1 Antibody Titration: 0.2-1 ug/mlPositive Control: Jurkat cell lysateSMARCE1 is strongly supported by BioGPS gene expression data to be expressed in Human Jurkat cells)

WB (Western Blot)

(Sample Type: Human, Mouse, RatLanes :Lane 1: HeLa (human)Lane 2: NHEM (human)Lane 3: Melba (mouse)Lane 4: NIH3T3 (mouse)Lane 5: S16 (rat)Lane 6: H9C2 (rat)Primary Antibody Dilution :1:500Secondary Antibody :Donkey anti-rabbit-HRPSecondary Antibody Dilution :1:5000Gene Name :SMARCE1Submitted by :Ivana de la Serna, University of Toledo)

product-image-AAA198269_WB10.jpg WB (Western Blot) (Sample Type: Human, Mouse, RatLanes :Lane 1: HeLa (human)Lane 2: NHEM (human)Lane 3: Melba (mouse)Lane 4: NIH3T3 (mouse)Lane 5: S16 (rat)Lane 6: H9C2 (rat)Primary Antibody Dilution :1:500Secondary Antibody :Donkey anti-rabbit-HRPSecondary Antibody Dilution :1:5000Gene Name :SMARCE1Submitted by :Ivana de la Serna, University of Toledo)

IHC (Immunohistochemisry)

(Rabbit Anti-SMARCE1 antibodyFormalin Fixed Paraffin Embedded Tissue: Human Adult ColonObserved Staining: Cytoplasm in hepatocytesPrimary Antibody Concentration: 1:600Secondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)

product-image-AAA198269_IHC11.jpg IHC (Immunohistochemisry) (Rabbit Anti-SMARCE1 antibodyFormalin Fixed Paraffin Embedded Tissue: Human Adult ColonObserved Staining: Cytoplasm in hepatocytesPrimary Antibody Concentration: 1:600Secondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)

IHC (Immunohiostchemistry)

(Rabbit Anti-SMARCE1 antibodyParaffin Embedded Tissue: Human Lungcell Cellular Data: alveolar cellAntibody Concentration: 4.0-8.0 ug/mlMagnification: 400X)

product-image-AAA198269_IHC13.jpg IHC (Immunohiostchemistry) (Rabbit Anti-SMARCE1 antibodyParaffin Embedded Tissue: Human Lungcell Cellular Data: alveolar cellAntibody Concentration: 4.0-8.0 ug/mlMagnification: 400X)

IHC (Immunohistochemistry)

(Human kidney)

product-image-AAA198269_IHC15.jpg IHC (Immunohistochemistry) (Human kidney)
Related Product Information for anti-SMARCE1 antibody
This is a rabbit polyclonal antibody against SMARCE1. It was validated on Western Blot and immunohistochemistry

Target Description: SMARCE1 is part of the large ATP-dependent chromatin remodeling complex SWI/SNF, which is required for transcriptional activation of genes normally repressed by chromatin. The protein, either alone or when in the SWI/SNF complex, can bind to 4-way junction DNA, which is thought to mimic the topology of DNA as it enters or exits the nucleosome. The protein contains a DNA-binding HMG domain, but disruption of this domain does not abolish the DNA-binding or nucleosome-displacement activities of the SWI/SNF complex. Unlike most of the SWI/SNF complex proteins, this protein has no yeast counterpart.The protein encoded by this gene is part of the large ATP-dependent chromatin remodeling complex SWI/SNF, which is required for transcriptional activation of genes normally repressed by chromatin. The encoded protein, either alone or when in the SWI/SNF complex, can bind to 4-way junction DNA, which is thought to mimic the topology of DNA as it enters or exits the nucleosome. The protein contains a DNA-binding HMG domain, but disruption of this domain does not abolish the DNA-binding or nucleosome-displacement activities of the SWI/SNF complex. Unlike most of the SWI/SNF complex proteins, this protein has no yeast counterpart.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
47kDa
NCBI Official Full Name
SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily E member 1
NCBI Official Synonym Full Names
SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily e, member 1
NCBI Official Symbol
SMARCE1
NCBI Official Synonym Symbols
CSS5; BAF57
NCBI Protein Information
SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily E member 1
UniProt Protein Name
SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily E member 1
UniProt Gene Name
SMARCE1
UniProt Synonym Gene Names
BAF57; BAF57
UniProt Entry Name
SMCE1_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The SMARCE1 smarce1 (Catalog #AAA198269) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The SMARCE1 antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's SMARCE1 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot), IHC (Immunohistochemistry). Researchers should empirically determine the suitability of the SMARCE1 smarce1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: MSKRPSYAPP PTPAPATQMP STPGFVGYNP YSHLAYNNYR LGGNPGTNSR. It is sometimes possible for the material contained within the vial of "SMARCE1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.