Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA162882_IHC11.jpg IHC (Immunohistochemisry) (SMG6 Antibody-Human Brain, Cortex: Formalin-Fixed, Paraffin-Embedded (FFPE))

Rabbit anti-Rat, Human SMG6 Polyclonal Antibody | anti-SMG6 antibody

SMG6 Rabbit anti-Human Polyclonal Antibody

Reactivity
Rat, Human
Applications
Western Blot, Immunohistochemistry, Immunohistochemistry
Purity
Affinity purified
Synonyms
SMG6, Antibody; SMG6 Rabbit anti-Human Polyclonal Antibody; IHC-plus SMG6 Antibody; SMG6; C17orf31; EST1-like protein A; Ever shorter telomeres 1A; KIAA0732; Smg-6 homolog; SMG-6; Telomerase subunit EST1A; EST1A; HSMG5/7a; anti-SMG6 antibody
Ordering
Host
Rabbit
Reactivity
Rat, Human
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity purified
Form/Format
PBS, pH7.3, 0.02% Sodium Azide, 50% Glycerol
Concentration
2.35mg/ml (varies by lot)
Applicable Applications for anti-SMG6 antibody
WB (Western Blot), IHC (Immunohistochemistry), IHC (Immunohistochemistry)
Target
Human SMG6
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 1160-1419 of human SMG6 (NP_060045.4). PDTMGKEMGSQEGTRLEDEEEDVVIEDFEEDSEAEGSGGEDDIRELRAKKLALARKIAEQQRRQEKIQAVLEDHSQMRQMELEIRPLFLVPDTNGFIDHLASLARLLESRKYILVVPLIVINELDGLAKGQETDHRAGGYARVVQEKARKSIEFLEQRFESRDSCLRALTSRGNELESIAFRSEDITGQLGNNDDLILSCCLHYCKDKAKDFMPASKEEPIRLLREVVLLTDDRNLRVKALTRNVPVRDIPAFLTWAQVG
Conjugation
Unconjugated
Preparation and Storage
Store at -20 degree C. Avoid freeze-thaw cycles.

IHC (Immunohistochemisry)

(SMG6 Antibody-Human Brain, Cortex: Formalin-Fixed, Paraffin-Embedded (FFPE))

product-image-AAA162882_IHC11.jpg IHC (Immunohistochemisry) (SMG6 Antibody-Human Brain, Cortex: Formalin-Fixed, Paraffin-Embedded (FFPE))

IHC (Immunohiostchemistry)

(SMG6 Antibody-Human Colon: Formalin-Fixed, Paraffin-Embedded (FFPE))

product-image-AAA162882_IHC13.jpg IHC (Immunohiostchemistry) (SMG6 Antibody-Human Colon: Formalin-Fixed, Paraffin-Embedded (FFPE))

WB (Western Blot)

(SMG6 Antibody-Western blot analysis of extracts of various cell lines, using SMG6 antibody at 1:1000 dilution. The secondary antibody used was an HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates were loaded 25ug per lane and 3% nonfat dry milk in TBST was used for blocking. An ECL Kit was used for detection and the exposure time was 30s.)

product-image-AAA162882_WB15.jpg WB (Western Blot) (SMG6 Antibody-Western blot analysis of extracts of various cell lines, using SMG6 antibody at 1:1000 dilution. The secondary antibody used was an HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates were loaded 25ug per lane and 3% nonfat dry milk in TBST was used for blocking. An ECL Kit was used for detection and the exposure time was 30s.)
Related Product Information for anti-SMG6 antibody
SMG6 antibody is an unconjugated rabbit polyclonal antibody to SMG6 from human. It is reactive with human and rat. Validated for IHC and WB. Tested on 20 paraffin-embedded human tissues.

NCBI and Uniprot Product Information

NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
UniProt Protein Name
Telomerase-binding protein EST1A
UniProt Gene Name
SMG6
UniProt Synonym Gene Names
C17orf31; EST1A; KIAA0732
UniProt Entry Name
EST1A_HUMAN

Similar Products

Product Notes

The SMG6 smg6 (Catalog #AAA162882) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The SMG6 Rabbit anti-Human Polyclonal Antibody reacts with Rat, Human and may cross-react with other species as described in the data sheet. AAA Biotech's SMG6 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot), IHC (Immunohistochemistry), IHC (Immunohistochemistry). Researchers should empirically determine the suitability of the SMG6 smg6 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "SMG6, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.