Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA46332_IHC13.jpg IHC (Immunohiostchemistry) (SMYD3 was detected in paraffin-embedded sections of human intestinal cancer tissues using rabbit anti- SMYD3 Antigen Affinity purified polyclonal antibody at 1ug/mL. The immunohistochemical section was developed using SABC method.)

anti-Human SMYD3 Polyclonal Antibody | anti-SMYD3 antibody

Anti-SMYD3 Antibody

Gene Names
SMYD3; KMT3E; ZMYND1; ZNFN3A1; bA74P14.1
Reactivity
Human
Applications
Immunohistochemistry, Western Blot
Purity
Immunogen Affinity Purified
Synonyms
SMYD3, Antibody; Anti-SMYD3 Antibody; Histone-lysine N-methyltransferase SMYD3; bA74P14.1 (novel protein); bA74P14.1; FLJ21080; histone lysine N methyltransferase SMYD3; KMT3E; MGC104324; SET and MYND domain containing 3; SET and MYND domain containing protein 3; SET and MYND domain-containing protein 3; SMYD 3; Smyd3; SMYD3 protein; SMYD3_HUMAN; Zinc finger MYND domain containing 1; Zinc finger MYND domain containing protein 1; Zinc finger MYND domain-containing protein 1; Zinc finger protein subfamily 3A MYND domain containing 1; Zinc finger protein, subfamily 3A (MYND domain containing), 1; ZMYND 1; ZMYND1; ZNFN3A1; anti-SMYD3 antibody
Ordering
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Immunogen Affinity Purified
Form/Format
Lyophilized. Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Sequence Length
428
Applicable Applications for anti-SMYD3 antibody
IHC (Immunohistochemistry), WB (Western Blot)
Immunogen
A synthetic peptide corresponding to a sequence at the C-terminus of human SMYD3 (388-428aa QAMKNLRLAFDIMRVTHGREHSLIEDLILLLEECDANIRAS), different from the related mouse sequence by one amino acid.
Ig Type
Rabbit IgG
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Preparation and Storage
At -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquoted and stored frozen at -20 degree C for a longer time. Avoid repeated freezing and thawing.

IHC (Immunohiostchemistry)

(SMYD3 was detected in paraffin-embedded sections of human intestinal cancer tissues using rabbit anti- SMYD3 Antigen Affinity purified polyclonal antibody at 1ug/mL. The immunohistochemical section was developed using SABC method.)

product-image-AAA46332_IHC13.jpg IHC (Immunohiostchemistry) (SMYD3 was detected in paraffin-embedded sections of human intestinal cancer tissues using rabbit anti- SMYD3 Antigen Affinity purified polyclonal antibody at 1ug/mL. The immunohistochemical section was developed using SABC method.)

WB (Western Blot)

(Western blot analysis of SMYD3 expression in HELA whole cell lysates (lane 1) and COLO320 whole cell lysates (lane 2). SMYD3 at 55KD was detected using rabbit anti- SMYD3 Antigen Affinity purified polyclonal antibody at0.5 ug/mL. The blot was developed using chemiluminescence (ECL) method.)

product-image-AAA46332_WB15.jpg WB (Western Blot) (Western blot analysis of SMYD3 expression in HELA whole cell lysates (lane 1) and COLO320 whole cell lysates (lane 2). SMYD3 at 55KD was detected using rabbit anti- SMYD3 Antigen Affinity purified polyclonal antibody at0.5 ug/mL. The blot was developed using chemiluminescence (ECL) method.)
Related Product Information for anti-SMYD3 antibody
Description: Rabbit IgG polyclonal antibody for Histone-lysine N-methyltransferase SMYD3(SMYD3) detection. Tested with WB, IHC-P in Human.

Background: SET and MYND domain-containing protein 3 is a protein that in humans is encoded by the SMYD3 gene. The International Radiation Hybrid Mapping Consortium mapped the SMYD3 gene to chromosome 1. This gene encodes a histone methyltransferase which functions in RNA polymerase II complexes by an interaction with a specific RNA helicase. Multiple transcript variants encoding different isoforms have been found for this gene.
References
1. Hamamoto, R., Furukawa, Y., Morita, M., Iimura, Y., Silva, F. P., Li, M., Yagyu, R., Nakamura, Y. SMYD3 encodes a histone methyltransferase involved in the proliferation of cancer cells. Nature Cell Biol. 6: 731-740, 2004. 2. Mazur, P. K., Reynoird, N., Khatri, P., Jansen, P. W. T. C., Wilkinson, A. W., Liu, S., Barbash, O., Van Aller, G. S., Huddleston, M., Dhanak, D., Tummino, P. J., Kruger, R. G., Garcia, B. A., Butte, A. J., Vermeulen, M., Sage, J., Gozani, O. SMYD3 links lysine methylation of MAP3K2 to Ras-driven cancer. Nature 510: 283-287, 2014. 3. Tsuge, M., Hamamoto, R., Silva, F. P., Ohnishi, Y., Chayama, K., Kamatani, N., Furukawa, Y., Nakamura, Y. A variable number of tandem repeats polymorphism in an E2F-1 binding element in the 5-prime flanking region of SMYD3 is a risk factor for human cancers. Nature Genet. 37: 1104-1107, 2005.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
42,625 Da
NCBI Official Full Name
histone-lysine N-methyltransferase SMYD3 isoform 1
NCBI Official Synonym Full Names
SET and MYND domain containing 3
NCBI Official Symbol
SMYD3
NCBI Official Synonym Symbols
KMT3E; ZMYND1; ZNFN3A1; bA74P14.1
NCBI Protein Information
histone-lysine N-methyltransferase SMYD3
UniProt Protein Name
Histone-lysine N-methyltransferase SMYD3
UniProt Gene Name
SMYD3
UniProt Synonym Gene Names
ZMYND1; ZNFN3A1
UniProt Entry Name
SMYD3_HUMAN

Similar Products

Product Notes

The SMYD3 smyd3 (Catalog #AAA46332) is an Antibody and is intended for research purposes only. The product is available for immediate purchase. The Anti-SMYD3 Antibody reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's SMYD3 can be used in a range of immunoassay formats including, but not limited to, IHC (Immunohistochemistry), WB (Western Blot). Researchers should empirically determine the suitability of the SMYD3 smyd3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "SMYD3, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.