Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA199614_WB11.jpg WB (Western Blot) (WB Suggested Antibody Titration: 2.5 ug/mlPositive Control: JurkatSOD1 is supported by BioGPS gene expression data to be expressed in Jurkat)

Rabbit anti-Human SOD1 Polyclonal Antibody | anti-SOD1 antibody

SOD1 antibody - N-terminal region

Average rating 0.0
No ratings yet
Gene Names
SOD1; ALS; SOD; ALS1; IPOA; hSod1; HEL-S-44; homodimer
Reactivity
Human
Applications
Western Blot, Immunohistochemistry
Purity
Protein A purified
Synonyms
SOD1, Antibody; SOD1 antibody - N-terminal region; anti-SOD1 antibody
Ordering
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Protein A purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: MATKAVCVLKGDGPVQGIINFEQKESNGPVKVWGSIKGLTEGLHGFHVHE
Sequence Length
154
Applicable Applications for anti-SOD1 antibody
WB (Western Blot), IHC (Immunohistochemistry)
Homology
Human: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human SOD1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Antibody Titration: 2.5 ug/mlPositive Control: JurkatSOD1 is supported by BioGPS gene expression data to be expressed in Jurkat)

product-image-AAA199614_WB11.jpg WB (Western Blot) (WB Suggested Antibody Titration: 2.5 ug/mlPositive Control: JurkatSOD1 is supported by BioGPS gene expression data to be expressed in Jurkat)

WB (Western Blot)

(Lanes:Lane 1: 50ug HeLa lysateLane 2: 50ug 293T lysateLane 3: 50ug K562 lysateLane 4: 50ug MDA-MB-231 lysatePrimary Antibody Dilution:1:500Secondary Antibody:Anti-rabbit-HRPSecondary Antibody Dilution:1:1000Gene Name:SOD1Submitted by:David Colecchia, Ph.D, Istituto Toscano Tumori, Core Research Laboratory, presso Fondazione Toscana Life Sciences)

product-image-AAA199614_WB13.jpg WB (Western Blot) (Lanes:Lane 1: 50ug HeLa lysateLane 2: 50ug 293T lysateLane 3: 50ug K562 lysateLane 4: 50ug MDA-MB-231 lysatePrimary Antibody Dilution:1:500Secondary Antibody:Anti-rabbit-HRPSecondary Antibody Dilution:1:1000Gene Name:SOD1Submitted by:David Colecchia, Ph.D, Istituto Toscano Tumori, Core Research Laboratory, presso Fondazione Toscana Life Sciences)

IHC (Immunohistochemistry)

(Human kidney)

product-image-AAA199614_IHC15.jpg IHC (Immunohistochemistry) (Human kidney)
Related Product Information for anti-SOD1 antibody
This is a rabbit polyclonal antibody against SOD1. It was validated on Western Blot and immunohistochemistry

Target Description: SOD1 binds copper and zinc ions and is one of two isozymes responsible for destroying free superoxide radicals in the body. This isozyme is a soluble cytoplasmic protein, acting as a homodimer to convert naturally-occuring but harmful superoxide radicals to molecular oxygen and hydrogen peroxide. The other isozyme is a mitochondrial protein. Mutations in its gene have been implicated as causes of familial amyotrophic lateral sclerosis.The protein encoded by this gene binds copper and zinc ions and is one of two isozymes responsible for destroying free superoxide radicals in the body. The encoded isozyme is a soluble cytoplasmic protein, acting as a homodimer to convert naturally-occuring but harmful superoxide radicals to molecular oxygen and hydrogen peroxide. The other isozyme is a mitochondrial protein. Mutations in this gene have been implicated as causes of familial amyotrophic lateral sclerosis. Rare transcript variants have been reported for this gene.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
16kDa
NCBI Official Full Name
superoxide dismutase
NCBI Official Synonym Full Names
superoxide dismutase 1
NCBI Official Symbol
SOD1
NCBI Official Synonym Symbols
ALS; SOD; ALS1; IPOA; hSod1; HEL-S-44; homodimer
NCBI Protein Information
superoxide dismutase [Cu-Zn]
UniProt Protein Name
Superoxide dismutase [Cu-Zn]
UniProt Gene Name
SOD1
UniProt Synonym Gene Names
hSod1
UniProt Entry Name
SODC_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The SOD1 sod1 (Catalog #AAA199614) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The SOD1 antibody - N-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's SOD1 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot), IHC (Immunohistochemistry). Researchers should empirically determine the suitability of the SOD1 sod1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: MATKAVCVLK GDGPVQGIIN FEQKESNGPV KVWGSIKGLT EGLHGFHVHE. It is sometimes possible for the material contained within the vial of "SOD1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.