Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA28427_IF6.jpg IF (Immunofluorescence) (Immunofluorescence analysis of U2OS cells using [KO Validated] SOD2 Rabbit pAb at dilution of 1:50 (40x lens). Blue: DAPI for nuclear staining.)

Rabbit SOD2 Polyclonal Antibody | anti-SOD2 antibody

SOD2 Rabbit pAb

Gene Names
ECE1; ECE
Reactivity
Human, Mouse, Rat
Applications
Immunofluorescence, Immunocytochemistry
Purity
Affinity purification
Synonyms
SOD2, Antibody; SOD2 Rabbit pAb; SOD2; IPO-B; IPOB; MNSOD; MVCD6; Mn-SOD; superoxide dismutase 2; anti-SOD2 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human, Mouse, Rat
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity purification
Form/Format
PBS with 0.01% thiomersal, 50% glycerol, pH7.3.
Sequence
ADNGGLKAAYRAYQNWVKKNGAEHSLPTLGLTNNQLFFLGFAQVWCSVRTPESSHEGLITDPHSPSRFRVIGSLSNSKEFSEHFRCPPGSPMNPPHKCEVW
Applicable Applications for anti-SOD2 antibody
Immunofluorescence (IF), Immunocytochemistry (ICC)
Application Notes
IF/ICC: 1:50-1:200
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 25-222 of human SOD2 (NP_000627.2).
Cellular Location
Mitochondrion matrix
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.

IF (Immunofluorescence)

(Immunofluorescence analysis of U2OS cells using [KO Validated] SOD2 Rabbit pAb at dilution of 1:50 (40x lens). Blue: DAPI for nuclear staining.)

product-image-AAA28427_IF6.jpg IF (Immunofluorescence) (Immunofluorescence analysis of U2OS cells using [KO Validated] SOD2 Rabbit pAb at dilution of 1:50 (40x lens). Blue: DAPI for nuclear staining.)

IF (Immunofluorescence)

(Immunofluorescence analysis of NIH/3T3 cells using [KO Validated] SOD2 Rabbit pAb at dilution of 1:50 (40x lens). Blue: DAPI for nuclear staining.)

product-image-AAA28427_IF5.jpg IF (Immunofluorescence) (Immunofluorescence analysis of NIH/3T3 cells using [KO Validated] SOD2 Rabbit pAb at dilution of 1:50 (40x lens). Blue: DAPI for nuclear staining.)

IF (Immunofluorescence)

(Immunofluorescence analysis of C6 cells using [KO Validated] SOD2 Rabbit pAb at dilution of 1:50 (40x lens). Blue: DAPI for nuclear staining.)

product-image-AAA28427_IF4.jpg IF (Immunofluorescence) (Immunofluorescence analysis of C6 cells using [KO Validated] SOD2 Rabbit pAb at dilution of 1:50 (40x lens). Blue: DAPI for nuclear staining.)

IHC (Immunohistochemistry)

(Immunohistochemistry of paraffin-embedded mouse kidney using SOD2 Rabbit pAb at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.)

product-image-AAA28427_IHC3.jpg IHC (Immunohistochemistry) (Immunohistochemistry of paraffin-embedded mouse kidney using SOD2 Rabbit pAb at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.)

IHC (Immunohistochemistry)

(Immunohistochemistry of paraffin-embedded human colon using SOD2 Rabbit pAb at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.)

product-image-AAA28427_IHC2.jpg IHC (Immunohistochemistry) (Immunohistochemistry of paraffin-embedded human colon using SOD2 Rabbit pAb at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.)

IHC (Immunohistochemistry)

(Immunohistochemistry of paraffin-embedded rat kidney using SOD2 Rabbit pAb at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.)

product-image-AAA28427_IHC.jpg IHC (Immunohistochemistry) (Immunohistochemistry of paraffin-embedded rat kidney using SOD2 Rabbit pAb at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.)
Related Product Information for anti-SOD2 antibody
This gene is a member of the iron/manganese superoxide dismutase family. It encodes a mitochondrial protein that forms a homotetramer and binds one manganese ion per subunit. This protein binds to the superoxide byproducts of oxidative phosphorylation and converts them to hydrogen peroxide and diatomic oxygen. Mutations in this gene have been associated with idiopathic cardiomyopathy (IDC), premature aging, sporadic motor neuron disease, and cancer. Alternative splicing of this gene results in multiple transcript variants. A related pseudogene has been identified on chromosome 1.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
770
NCBI Official Full Name
endothelin-converting enzyme 1 isoform 3
NCBI Official Synonym Full Names
endothelin converting enzyme 1
NCBI Official Symbol
ECE1
NCBI Official Synonym Symbols
ECE
NCBI Protein Information
endothelin-converting enzyme 1; ECE-1
UniProt Protein Name
Endothelin-converting enzyme 1
UniProt Gene Name
ECE1
UniProt Synonym Gene Names
ECE-1
UniProt Entry Name
ECE1_HUMAN

Similar Products

Product Notes

The SOD2 ece1 (Catalog #AAA28427) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The SOD2 Rabbit pAb reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's SOD2 can be used in a range of immunoassay formats including, but not limited to, Immunofluorescence (IF), Immunocytochemistry (ICC). IF/ICC: 1:50-1:200. Researchers should empirically determine the suitability of the SOD2 ece1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: ADNGGLKAAY RAYQNWVKKN GAEHSLPTLG LTNNQLFFLG FAQVWCSVRT PESSHEGLIT DPHSPSRFRV IGSLSNSKEF SEHFRCPPGS PMNPPHKCEV W. It is sometimes possible for the material contained within the vial of "SOD2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.