Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA23462_WB9.jpg WB (Western Blot) (WB Suggested Anti-SOX4 Antibody Titration: 1 ug/mlPositive Control: Hela cell lysate)

Rabbit SOX4 Polyclonal Antibody | anti-SOX4 antibody

SOX4 antibody - N-terminal region

Average rating 0.0
No ratings yet
Gene Names
SOX4; EVI16
Reactivity
Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Immunohistochemistry, Western Blot
Purity
Affinity Purified
Synonyms
SOX4, Antibody; SOX4 antibody - N-terminal region; anti-SOX4 antibody
Ordering
Host
Rabbit
Reactivity
Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Specificity
Peptide immunogen shares 93% with human SOX11.
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: STASTGGKADDPSWCKTPSGHIKRPMNAFMVWSQIERRKIMEQSPDMHNA
Sequence Length
474
Applicable Applications for anti-SOX4 antibody
IHC (Immunohistochemistry), WB (Western Blot)
Homology
Cow: 100%; Dog: 100%; Goat: 91%; Guinea Pig: 100%; Horse: 93%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human SOX4
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-SOX4 Antibody Titration: 1 ug/mlPositive Control: Hela cell lysate)

product-image-AAA23462_WB9.jpg WB (Western Blot) (WB Suggested Anti-SOX4 Antibody Titration: 1 ug/mlPositive Control: Hela cell lysate)

WB (Western Blot)

(WB Suggested Anti-SOX4 Antibody Titration: 0.2-1 ug/ml.A: - blocking peptide.B: + blocking peptide.)

product-image-AAA23462_WB8.jpg WB (Western Blot) (WB Suggested Anti-SOX4 Antibody Titration: 0.2-1 ug/ml.A: - blocking peptide.B: + blocking peptide.)

WB (Western Blot)

(lane 1: Human Testisprimary antibody:SOX4 antibody - N-terminal region primary antibody dilution: 1:1000secondary antibody: goat anti-rabbit-HRPsecondary antibody dilution: 1:10,000blocking buffer: 3% milk in TBSTActual Primary Conc (mg/mL): 0.9Expected Primary Conc (mg/ml): 0.5 )

product-image-AAA23462_WB7.jpg WB (Western Blot) (lane 1: Human Testisprimary antibody:SOX4 antibody - N-terminal region primary antibody dilution: 1:1000secondary antibody: goat anti-rabbit-HRPsecondary antibody dilution: 1:10,000blocking buffer: 3% milk in TBSTActual Primary Conc (mg/mL): 0.9Expected Primary Conc (mg/ml): 0.5 )

WB (Western Blot)

(lane 1: Human Testisprimary antibody:SOX4 antibody - N-terminal region primary antibody dilution: 1:1000secondary antibody: goat anti-rabbit-HRPsecondary antibody dilution: 1:10,000blocking buffer: 3% milk in TBSTActual Primary Conc (mg/mL): 1.9Expected Primary Conc (mg/ml): 0.5 )

product-image-AAA23462_WB6.jpg WB (Western Blot) (lane 1: Human Testisprimary antibody:SOX4 antibody - N-terminal region primary antibody dilution: 1:1000secondary antibody: goat anti-rabbit-HRPsecondary antibody dilution: 1:10,000blocking buffer: 3% milk in TBSTActual Primary Conc (mg/mL): 1.9Expected Primary Conc (mg/ml): 0.5 )

WB (Western Blot)

(Host: RabbitTarget Name: SOX4Sample Type: Human Fetal LiverAntibody Dilution: 1.0ug/ml)

product-image-AAA23462_WB5.jpg WB (Western Blot) (Host: RabbitTarget Name: SOX4Sample Type: Human Fetal LiverAntibody Dilution: 1.0ug/ml)

WB (Western Blot)

(Host: RabbitTarget Name: SOX4Sample Type: HelaLane A: Primary AntibodyLane B: Primary Antibody + Blocking PeptidePrimary Antibody Concentration: 1ug/mlPeptide Concentration: 5ug/mlLysate Quantity: 25ug/lane/laneGel Concentration: 0.12)

product-image-AAA23462_WB4.jpg WB (Western Blot) (Host: RabbitTarget Name: SOX4Sample Type: HelaLane A: Primary AntibodyLane B: Primary Antibody + Blocking PeptidePrimary Antibody Concentration: 1ug/mlPeptide Concentration: 5ug/mlLysate Quantity: 25ug/lane/laneGel Concentration: 0.12)

WB (Western Blot)

(Host: RabbitTarget Name: SOX4Sample Tissue: Human Fetal StomachAntibody Dilution: 1.0ug/ml)

product-image-AAA23462_WB3.jpg WB (Western Blot) (Host: RabbitTarget Name: SOX4Sample Tissue: Human Fetal StomachAntibody Dilution: 1.0ug/ml)

WB (Western Blot)

(Host: MouseTarget Name: SOX12Sample Tissue: Mouse LiverAntibody Dilution: 1ug/ml)

product-image-AAA23462_WB2.jpg WB (Western Blot) (Host: MouseTarget Name: SOX12Sample Tissue: Mouse LiverAntibody Dilution: 1ug/ml)

IHC (Immunohistochemistry)

(Human Testis)

product-image-AAA23462_IHC.jpg IHC (Immunohistochemistry) (Human Testis)
Related Product Information for anti-SOX4 antibody
This is a rabbit polyclonal antibody against SOX4. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: SOX4 is a member of the SOX (SRY-related HMG-box) family of transcription factors involved in the regulation of embryonic development and in the determination of the cell fate. It may act as a transcriptional regulator after forming a protein complex with other proteins, such as syndecan binding protein (syntenin). The protein may function in the apoptosis pathway leading to cell death as well as to tumorigenesis and may mediate downstream effects of parathyroid hormone (PTH) and PTH-related protein (PTHrP) in bone development. The solution structure has been resolved for the HMG-box of a similar mouse protein.This intronless gene encodes a member of the SOX (SRY-related HMG-box) family of transcription factors involved in the regulation of embryonic development and in the determination of the cell fate. The encoded protein may act as a transcriptional regulator after forming a protein complex with other proteins, such as syndecan binding protein (syntenin). The protein may function in the apoptosis pathway leading to cell death as well as to tumorigenesis and may mediate downstream effects of parathyroid hormone (PTH) and PTH-related protein (PTHrP) in bone development. The solution structure has been resolved for the HMG-box of a similar mouse protein. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
47kDa
NCBI Official Full Name
transcription factor SOX-4
NCBI Official Synonym Full Names
SRY-box 4
NCBI Official Symbol
SOX4
NCBI Official Synonym Symbols
EVI16
NCBI Protein Information
transcription factor SOX-4
UniProt Protein Name
Transcription factor SOX-4
UniProt Gene Name
SOX4
UniProt Entry Name
SOX4_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The SOX4 sox4 (Catalog #AAA23462) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The SOX4 antibody - N-terminal region reacts with Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's SOX4 can be used in a range of immunoassay formats including, but not limited to, IHC (Immunohistochemistry), WB (Western Blot). Researchers should empirically determine the suitability of the SOX4 sox4 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: STASTGGKAD DPSWCKTPSG HIKRPMNAFM VWSQIERRKI MEQSPDMHNA. It is sometimes possible for the material contained within the vial of "SOX4, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.