Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA23593_APP8.jpg Application Data (Surface Plasmon Resonance Kinetic Characterization of Polyclonal Antibody Affinity. Purified polyclonal antibodies were immobilized on a Protein A/G coated Carterra LSA sensor chip at concentrations of 5, and 50 ug/mL in duplicate. Antibodies on the surface were exposed to interaction with peptides sequentially via microfluidic controlled flow at 333nM peptide concentration for kinetic characterization of the binders for affinity and specificity, followed by curve fitting using the Kinetics software. Kd determinations for both concentrations were averaged and results and standard deviation are shown.)

Rabbit anti-Human SPAM1 Polyclonal Antibody | anti-SPAM1 antibody

SPAM1 Antibody - C-terminal region

Gene Names
SPAM1; HYA1; PH20; HYAL1; HYAL3; HYAL5; PH-20; SPAG15; HEL-S-96n
Reactivity
Human
Applications
Western Blot
Purity
Affinity Purified
Synonyms
SPAM1, Antibody; SPAM1 Antibody - C-terminal region; anti-SPAM1 antibody
Ordering
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration
0.5 mg/ml (varies by lot)
Sequence
Synthetic peptide located within the following region: CYSTLSCKEKADVKDTDAVDVCIADGVCIDAFLKPPMETEEPQIFYNASP
Sequence Length
509
Applicable Applications for anti-SPAM1 antibody
WB (Western Blot)
Homology
Human: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the C-terminal region of Human SPAM1
Protein Size (# AA)
509 amino acids
Preparation and Storage
For short term use, store at 2-8°C up to 1 week. For long term storage, store at -20°C in small aliquots to prevent freeze-thaw cycles.

Application Data

(Surface Plasmon Resonance Kinetic Characterization of Polyclonal Antibody Affinity. Purified polyclonal antibodies were immobilized on a Protein A/G coated Carterra LSA sensor chip at concentrations of 5, and 50 ug/mL in duplicate. Antibodies on the surface were exposed to interaction with peptides sequentially via microfluidic controlled flow at 333nM peptide concentration for kinetic characterization of the binders for affinity and specificity, followed by curve fitting using the Kinetics software. Kd determinations for both concentrations were averaged and results and standard deviation are shown.)

product-image-AAA23593_APP8.jpg Application Data (Surface Plasmon Resonance Kinetic Characterization of Polyclonal Antibody Affinity. Purified polyclonal antibodies were immobilized on a Protein A/G coated Carterra LSA sensor chip at concentrations of 5, and 50 ug/mL in duplicate. Antibodies on the surface were exposed to interaction with peptides sequentially via microfluidic controlled flow at 333nM peptide concentration for kinetic characterization of the binders for affinity and specificity, followed by curve fitting using the Kinetics software. Kd determinations for both concentrations were averaged and results and standard deviation are shown.)

WB (Western Blot)

(Host: Rabbit Target Name: SPAM1 Sample Tissue: Human HepG2 Whole Cell Antibody Dilution: 0.2ug/ml.)

product-image-AAA23593_WB7.jpg WB (Western Blot) (Host: Rabbit Target Name: SPAM1 Sample Tissue: Human HepG2 Whole Cell Antibody Dilution: 0.2ug/ml.)

WB (Western Blot)

(Host: Rabbit Target Name: SPAM1 Sample Tissue: Human HT1080 Whole Cell Antibody Dilution: 1ug/ml.)

product-image-AAA23593_WB6.jpg WB (Western Blot) (Host: Rabbit Target Name: SPAM1 Sample Tissue: Human HT1080 Whole Cell Antibody Dilution: 1ug/ml.)

WB (Western Blot)

(Host: Rabbit Target Name: SPAM1 Sample Tissue: Human Jurkat Whole Cell Antibody Dilution: 3ug/mlb.)

product-image-AAA23593_WB5.jpg WB (Western Blot) (Host: Rabbit Target Name: SPAM1 Sample Tissue: Human Jurkat Whole Cell Antibody Dilution: 3ug/mlb.)

WB (Western Blot)

(Host: Rabbit Target Name: SPAM1 Sample Tissue: Human A549 Whole Cell Antibody Dilution: 3ug/ml.)

product-image-AAA23593_WB4.jpg WB (Western Blot) (Host: Rabbit Target Name: SPAM1 Sample Tissue: Human A549 Whole Cell Antibody Dilution: 3ug/ml.)

WB (Western Blot)

(WB Suggested Anti-SPAM1 AntibodyTitration: 1.0 ug/mlPositive Control: Jurkat Whole Cell)

product-image-AAA23593_WB3.jpg WB (Western Blot) (WB Suggested Anti-SPAM1 AntibodyTitration: 1.0 ug/mlPositive Control: Jurkat Whole Cell)

WB (Western Blot)

(Host: RabbitTarget Name: SPAM1Sample Type: Human Adult PlacentaAntibody Dilution: 1.0ug/ml)

product-image-AAA23593_WB2.jpg WB (Western Blot) (Host: RabbitTarget Name: SPAM1Sample Type: Human Adult PlacentaAntibody Dilution: 1.0ug/ml)

WB (Western Blot)

(Host: RabbitTarget Name: SPAM1Sample Type: 293TAntibody Dilution: 1.0ug/ml)

product-image-AAA23593_WB.jpg WB (Western Blot) (Host: RabbitTarget Name: SPAM1Sample Type: 293TAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-SPAM1 antibody
Target Description: Hyaluronidase degrades hyaluronic acid, a major structural proteoglycan found in extracellular matrices and basement membranes. Six members of the hyaluronidase family are clustered into two tightly linked groups on chromosome 3p21.3 and 7q31.3. This gene was previously referred to as HYAL1 and HYA1 and has since been assigned the official symbol SPAM1; another family member on chromosome 3p21.3 has been assigned HYAL1. This gene encodes a GPI-anchored enzyme located on the human sperm surface and inner acrosomal membrane. This multifunctional protein is a hyaluronidase that enables sperm to penetrate through the hyaluronic acid-rich cumulus cell layer surrounding the oocyte, a receptor that plays a role in hyaluronic acid induced cell signaling, and a receptor that is involved in sperm-zona pellucida adhesion. Abnormal expression of this gene in tumors has implicated this protein in degradation of basement membranes leading to tumor invasion and metastasis. Multiple transcript variants encoding different isoforms have been found for this gene.
Product Categories/Family for anti-SPAM1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
58kDa
NCBI Official Full Name
hyaluronidase PH-20 isoform 2
NCBI Official Synonym Full Names
sperm adhesion molecule 1
NCBI Official Symbol
SPAM1
NCBI Official Synonym Symbols
HYA1; PH20; HYAL1; HYAL3; HYAL5; PH-20; SPAG15; HEL-S-96n
NCBI Protein Information
hyaluronidase PH-20
UniProt Protein Name
Hyaluronidase PH-20
UniProt Gene Name
SPAM1
UniProt Synonym Gene Names
HYAL3; PH20; Hyal-PH20
UniProt Entry Name
HYALP_HUMAN

Similar Products

Product Notes

The SPAM1 spam1 (Catalog #AAA23593) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The SPAM1 Antibody - C-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's SPAM1 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the SPAM1 spam1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: CYSTLSCKEK ADVKDTDAVD VCIADGVCID AFLKPPMETE EPQIFYNASP. It is sometimes possible for the material contained within the vial of "SPAM1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.