Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA282248_WB13.jpg WB (Western Blot) (Western blot analysis of extracts of Rat brain, using SPARCL1 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Enhanced Kit.Exposure time: 90s.)

Rabbit SPARCL1 Polyclonal Antibody | anti-SPARCL1 antibody

SPARCL1 Rabbit pAb

Average rating 0.0
No ratings yet
Gene Names
G6PC; G6PT; GSD1; G6PC1; GSD1a
Reactivity
Human, Mouse, Rat
Applications
Western Blot
Purity
Affinity purification
Synonyms
SPARCL1, Antibody; SPARCL1 Rabbit pAb; SC1; MAST9; PIG33; MAST 9; anti-SPARCL1 antibody
Ordering
Host
Rabbit
Reactivity
Human, Mouse, Rat
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity purification
Form/Format
PBS with 0.01% thiomersal, 50% glycerol, pH7.3.
Sequence
SIYNASLKKYFLITFFLFSFAIGFYLLLKGLGVDLLWTLEKAQRWCEQPEWVHIDTTPFASLLKNLGTLFGLGLALNSSMYRESCKGKLSKWLPFRLSSIV
Applicable Applications for anti-SPARCL1 antibody
WB (Western Blot)
Positive Samples
Mouse brain, Rat brain
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 17-300 of human SPARCL1 (NP_004675.3).
Cellular Location
endoplasmic reticulum lumen, extracellular region, extracellular space, glutamatergic synapse
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.

WB (Western Blot)

(Western blot analysis of extracts of Rat brain, using SPARCL1 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Enhanced Kit.Exposure time: 90s.)

product-image-AAA282248_WB13.jpg WB (Western Blot) (Western blot analysis of extracts of Rat brain, using SPARCL1 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Enhanced Kit.Exposure time: 90s.)

WB (Western Blot)

(Western blot analysis of extracts of Mouse brain, using SPARCL1 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 90s.)

product-image-AAA282248_WB15.jpg WB (Western Blot) (Western blot analysis of extracts of Mouse brain, using SPARCL1 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 90s.)
Related Product Information for anti-SPARCL1 antibody
Predicted to enable calcium ion binding activity; collagen binding activity; and extracellular matrix binding activity. Predicted to be involved in anatomical structure development and regulation of synapse organization. Located in extracellular space.
Product Categories/Family for anti-SPARCL1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
UniProt Accession #
Molecular Weight
40,484 Da
NCBI Official Full Name
Glucose-6-phosphatase
NCBI Official Synonym Full Names
glucose-6-phosphatase, catalytic subunit
NCBI Official Symbol
G6PC
NCBI Official Synonym Symbols
G6PT; GSD1; G6PC1; GSD1a
NCBI Protein Information
glucose-6-phosphatase; G6Pase; G-6-Pase; G6Pase-alpha; glucose-6-phosphatase alpha
UniProt Protein Name
Glucose-6-phosphatase
UniProt Gene Name
G6PC
UniProt Synonym Gene Names
G6PT; G-6-Pase; G6Pase
UniProt Entry Name
G6PC_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The SPARCL1 g6pc (Catalog #AAA282248) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The SPARCL1 Rabbit pAb reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's SPARCL1 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the SPARCL1 g6pc for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: SIYNASLKKY FLITFFLFSF AIGFYLLLKG LGVDLLWTLE KAQRWCEQPE WVHIDTTPFA SLLKNLGTLF GLGLALNSSM YRESCKGKLS KWLPFRLSSI V. It is sometimes possible for the material contained within the vial of "SPARCL1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.