WB (Western Blot)
(WB Suggested Anti-SPPL2B Antibody Titration: 1 ug/mlPositive Control: Jurkat cell lysateSPPL2B is supported by BioGPS gene expression data to be expressed in Jurkat)
Rabbit SPPL2B Polyclonal Antibody | anti-SPPL2B antibody
SPPL2B antibody - N-terminal region
Gene Names
SPPL2B; IMP4; PSH4; PSL1; IMP-4
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rat
Applications
Western Blot, Immunohistochemistry
Purity
Affinity Purified
Synonyms
SPPL2B, Antibody; SPPL2B antibody - N-terminal region; anti-SPPL2B antibody
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: VARGNCTFYEKVRLAQGSGARGLLIVSRERLVPPGGNKTQYDEIGIPVAL
Sequence Length
511
Applicable Applications for anti-SPPL2B antibody
WB (Western Blot), IHC (Immunohistochemistry)
Homology
Cow: 86%; Dog: 86%; Guinea Pig: 79%; Horse: 86%; Human: 100%; Mouse: 86%; Pig: 86%; Rat: 86%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human SPPL2B
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
WB (Western Blot)
(WB Suggested Anti-SPPL2B Antibody Titration: 1 ug/mlPositive Control: Jurkat cell lysateSPPL2B is supported by BioGPS gene expression data to be expressed in Jurkat)
WB (Western Blot)
(WB Suggested Anti-SPPL2B Antibody Titration: 1 ug/mlPositive Control: Jurkat cell lysateSPPL2B is supported by BioGPS gene expression data to be expressed in Jurkat)
IHC (Immunohistochemistry)
(Human kidney)
IHC (Immunohistochemistry)
(Human kidney)
Related Product Information for anti-SPPL2B antibody
This is a rabbit polyclonal antibody against SPPL2B. It was validated on Western Blot and immunohistochemistry
Target Description: SPPL2B is a member of the GXGD family of aspartic proteases. The GXGD proteases are transmembrane proteins with two conserved catalytic motifs localized within the membrane-spanning regions. This enzyme localizes to endosomes, lysosomes, and the plasma membrane. It cleaves the transmembrane domain of tumor necrosis factor alpha to release the intracellular domain, which triggers cytokine expression in the innate and adaptive immunity pathways.
Target Description: SPPL2B is a member of the GXGD family of aspartic proteases. The GXGD proteases are transmembrane proteins with two conserved catalytic motifs localized within the membrane-spanning regions. This enzyme localizes to endosomes, lysosomes, and the plasma membrane. It cleaves the transmembrane domain of tumor necrosis factor alpha to release the intracellular domain, which triggers cytokine expression in the innate and adaptive immunity pathways.
Product Categories/Family for anti-SPPL2B antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
56kDa
NCBI Official Full Name
signal peptide peptidase-like 2B isoform 3
NCBI Official Synonym Full Names
signal peptide peptidase like 2B
NCBI Official Symbol
SPPL2B
NCBI Official Synonym Symbols
IMP4; PSH4; PSL1; IMP-4
NCBI Protein Information
signal peptide peptidase-like 2B
UniProt Protein Name
Signal peptide peptidase-like 2B
UniProt Gene Name
SPPL2B
UniProt Synonym Gene Names
IMP4; KIAA1532; PSL1
UniProt Entry Name
PSL1_HUMAN
Similar Products
Product Notes
The SPPL2B sppl2b (Catalog #AAA199506) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The SPPL2B antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's SPPL2B can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot), IHC (Immunohistochemistry). Researchers should empirically determine the suitability of the SPPL2B sppl2b for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: VARGNCTFYE KVRLAQGSGA RGLLIVSRER LVPPGGNKTQ YDEIGIPVAL. It is sometimes possible for the material contained within the vial of "SPPL2B, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.