Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA201020_WB13.jpg WB (Western Blot) (WB Suggested Anti-SPSB2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: HepG2 cell lysate)

Rabbit SPSB2 Polyclonal Antibody | anti-SPSB2 antibody

SPSB2 antibody - N-terminal region

Gene Names
SPSB2; SSB2; GRCC9
Reactivity
Cow, Dog, Guinea Pig, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Western Blot, Immunohistochemistry
Purity
Affinity Purified
Synonyms
SPSB2, Antibody; SPSB2 antibody - N-terminal region; anti-SPSB2 antibody
Ordering
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: KDCSENIEVKEGGLYFERRPVAQSTDGARGKRGYSRGLHAWEISWPLEQR
Sequence Length
263
Applicable Applications for anti-SPSB2 antibody
WB (Western Blot), IHC (Immunohistochemistry)
Homology
Cow: 100%; Dog: 93%; Guinea Pig: 100%; Human: 100%; Mouse: 93%; Rabbit: 100%; Rat: 93%; Zebrafish: 79%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human SPSB2
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-SPSB2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: HepG2 cell lysate)

product-image-AAA201020_WB13.jpg WB (Western Blot) (WB Suggested Anti-SPSB2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: HepG2 cell lysate)

IHC (Immunohistochemistry)

(Sample Type :Rhesus macaque spinal cordPrimary Antibody Dilution :1:300Secondary Antibody :Donkey anti Rabbit 488Secondary Antibody Dilution :1:500Color/Signal Descriptions :Green: SPSB2Gene Name :SPSB2Submitted by :Timur Mavlyutov, Ph. D., Department of Pharmacology, University of Wisconsin Medical School, 1300 University Avenue, Madison, WI 53706)

product-image-AAA201020_IHC15.jpg IHC (Immunohistochemistry) (Sample Type :Rhesus macaque spinal cordPrimary Antibody Dilution :1:300Secondary Antibody :Donkey anti Rabbit 488Secondary Antibody Dilution :1:500Color/Signal Descriptions :Green: SPSB2Gene Name :SPSB2Submitted by :Timur Mavlyutov, Ph. D., Department of Pharmacology, University of Wisconsin Medical School, 1300 University Avenue, Madison, WI 53706)
Related Product Information for anti-SPSB2 antibody
This is a rabbit polyclonal antibody against SPSB2. It was validated on Western Blot

Target Description: This gene encodes encodes a suppressor of cytokine signaling (SOCS) family member, and it belongs to the subfamily of proteins containing a central SPRY (repeats in splA and RyR) domain and a C-terminal SOCS box. This gene is present in a gene-rich cluster on chromosome 12p13 in the vicinity of the CD4 antigen and triosephosphate isomerase genes.
Product Categories/Family for anti-SPSB2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
28kDa
NCBI Official Full Name
SPRY domain-containing SOCS box protein 2
NCBI Official Synonym Full Names
splA/ryanodine receptor domain and SOCS box containing 2
NCBI Official Symbol
SPSB2
NCBI Official Synonym Symbols
SSB2; GRCC9
NCBI Protein Information
SPRY domain-containing SOCS box protein 2
UniProt Protein Name
SPRY domain-containing SOCS box protein 2
UniProt Gene Name
SPSB2
UniProt Synonym Gene Names
GRCC9; SSB2; SSB-2
UniProt Entry Name
SPSB2_HUMAN

Similar Products

Product Notes

The SPSB2 spsb2 (Catalog #AAA201020) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The SPSB2 antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's SPSB2 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot), IHC (Immunohistochemistry). Researchers should empirically determine the suitability of the SPSB2 spsb2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: KDCSENIEVK EGGLYFERRP VAQSTDGARG KRGYSRGLHA WEISWPLEQR. It is sometimes possible for the material contained within the vial of "SPSB2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.