Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA199408_WB11.jpg WB (Western Blot) (WB Suggested Anti-SRD5A2 Antibody Titration: 0.2-1 ug/mlPositive Control: THP-1 cell lysate)

Rabbit SRD5A2 Polyclonal Antibody | anti-SRD5A2 antibody

SRD5A2 antibody - N-terminal region

Reactivity
Human, Pig, Rabbit, Monkey
Applications
Western Blot, Immunohistochemistry
Purity
Affinity Purified
Synonyms
SRD5A2, Antibody; SRD5A2 antibody - N-terminal region; anti-SRD5A2 antibody
Ordering
Host
Rabbit
Reactivity
Human, Pig, Rabbit, Monkey
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: MQVQCQQSPVLAGSATLVALGALALYVAKPSGYGKHTESLKPAATRLPAR
Sequence Length
254
Applicable Applications for anti-SRD5A2 antibody
WB (Western Blot), IHC (Immunohistochemistry)
Homology
Human: 100%; Pig: 86%; Rabbit: 91%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human SRD5A2
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-SRD5A2 Antibody Titration: 0.2-1 ug/mlPositive Control: THP-1 cell lysate)

product-image-AAA199408_WB11.jpg WB (Western Blot) (WB Suggested Anti-SRD5A2 Antibody Titration: 0.2-1 ug/mlPositive Control: THP-1 cell lysate)

IHC (Immunohiostchemistry)

(Sample Type: Monkey vaginaSample Type :Monkey vaginaPrimary Antibody Dilution :1:25Secondary Antibody:Anti-rabbit-HRPSecondary Antibody Dilution:1:1000Color/Signal Descriptions:Brown: SRD5A2 Blue: NucleusGene Name:SRD5A2Submitted by:Jonathan Bertin, Endoceutics Inc.)

product-image-AAA199408_IHC13.jpg IHC (Immunohiostchemistry) (Sample Type: Monkey vaginaSample Type :Monkey vaginaPrimary Antibody Dilution :1:25Secondary Antibody:Anti-rabbit-HRPSecondary Antibody Dilution:1:1000Color/Signal Descriptions:Brown: SRD5A2 Blue: NucleusGene Name:SRD5A2Submitted by:Jonathan Bertin, Endoceutics Inc.)

IHC (Immunohistochemistry)

(Sample Type: Monkey adrenal glandSample Type :Monkey adrenal glandPrimary Antibody Dilution :1:25Secondary Antibody:Anti-rabbit-HRPSecondary Antibody Dilution:1:1000Color/Signal Descriptions:Brown: SRD5A2 Blue: NucleusGene Name:SRD5A2Submitted by:Jonathan Bertin, Endoceutics Inc.)

product-image-AAA199408_IHC15.jpg IHC (Immunohistochemistry) (Sample Type: Monkey adrenal glandSample Type :Monkey adrenal glandPrimary Antibody Dilution :1:25Secondary Antibody:Anti-rabbit-HRPSecondary Antibody Dilution:1:1000Color/Signal Descriptions:Brown: SRD5A2 Blue: NucleusGene Name:SRD5A2Submitted by:Jonathan Bertin, Endoceutics Inc.)
Related Product Information for anti-SRD5A2 antibody
This is a rabbit polyclonal antibody against SRD5A2. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: This gene encodes a microsomal protein expressed at high levels in androgen-sensitive tissues such as the prostate. The encoded protein is active at acidic pH and is sensitive to the 4-azasteroid inhibitor finasteride. Deficiencies in this gene can result

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
28kDa
NCBI Official Full Name
3-oxo-5-alpha-steroid 4-dehydrogenase 2
NCBI Official Synonym Full Names
steroid 5 alpha-reductase 2
NCBI Official Symbol
SRD5A2
NCBI Protein Information
3-oxo-5-alpha-steroid 4-dehydrogenase 2
UniProt Protein Name
3-oxo-5-alpha-steroid 4-dehydrogenase 2
UniProt Gene Name
SRD5A2
UniProt Synonym Gene Names
S5AR 2
UniProt Entry Name
S5A2_MACFA

Similar Products

Product Notes

The SRD5A2 srd5a2 (Catalog #AAA199408) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The SRD5A2 antibody - N-terminal region reacts with Human, Pig, Rabbit, Monkey and may cross-react with other species as described in the data sheet. AAA Biotech's SRD5A2 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot), IHC (Immunohistochemistry). Researchers should empirically determine the suitability of the SRD5A2 srd5a2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: MQVQCQQSPV LAGSATLVAL GALALYVAKP SGYGKHTESL KPAATRLPAR. It is sometimes possible for the material contained within the vial of "SRD5A2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.