Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA23446_WB7.jpg WB (Western Blot) (WB Suggested Anti-SSX4 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: HepG2 cell lysate)

Rabbit anti-Human SSX4 Polyclonal Antibody | anti-SSX4 antibody

SSX4 antibody - middle region

Average rating 0.0
No ratings yet
Gene Names
SSX4; CT5.4
Reactivity
Human
Applications
Immunohistochemistry, Western Blot
Purity
Affinity Purified
Synonyms
SSX4, Antibody; SSX4 antibody - middle region; anti-SSX4 antibody
Ordering
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: FPKIMPKKPAEEENGLKEVPEASGPQNDGKQLCPPGNPSTLEKINKTSGP
Sequence Length
188
Applicable Applications for anti-SSX4 antibody
IHC (Immunohistochemistry), WB (Western Blot)
Homology
Human: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human SSX4
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-SSX4 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: HepG2 cell lysate)

product-image-AAA23446_WB7.jpg WB (Western Blot) (WB Suggested Anti-SSX4 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: HepG2 cell lysate)

WB (Western Blot)

(Host: RabbitTarget Name: SSX4Sample Type: MCF7Antibody Dilution: 1.0ug/ml)

product-image-AAA23446_WB6.jpg WB (Western Blot) (Host: RabbitTarget Name: SSX4Sample Type: MCF7Antibody Dilution: 1.0ug/ml)

WB (Western Blot)

(Host: RabbitTarget Name: SSX4Sample Type: JurkatAntibody Dilution: 1.0ug/ml)

product-image-AAA23446_WB5.jpg WB (Western Blot) (Host: RabbitTarget Name: SSX4Sample Type: JurkatAntibody Dilution: 1.0ug/ml)

WB (Western Blot)

(Host: RabbitTarget Name: SSX4Sample Type: HepG2Antibody Dilution: 1.0ug/ml)

product-image-AAA23446_WB4.jpg WB (Western Blot) (Host: RabbitTarget Name: SSX4Sample Type: HepG2Antibody Dilution: 1.0ug/ml)

WB (Western Blot)

(Host: RabbitTarget Name: SSX4Sample Type: HelaAntibody Dilution: 1.0ug/ml)

product-image-AAA23446_WB3.jpg WB (Western Blot) (Host: RabbitTarget Name: SSX4Sample Type: HelaAntibody Dilution: 1.0ug/ml)

WB (Western Blot)

(Host: RabbitTarget Name: SSX4Sample Type: 721_BAntibody Dilution: 1.0ug/mlSSX4 is strongly supported by BioGPS gene expression data to be expressed in Human 721_B cells)

product-image-AAA23446_WB2.jpg WB (Western Blot) (Host: RabbitTarget Name: SSX4Sample Type: 721_BAntibody Dilution: 1.0ug/mlSSX4 is strongly supported by BioGPS gene expression data to be expressed in Human 721_B cells)

IHC (Immunohistochemistry)

(Immunohistochemistry with Human Prostate lysate tissue at an antibody concentration of 5.0ug/ml using anti-SSX4 antibody)

product-image-AAA23446_IHC.jpg IHC (Immunohistochemistry) (Immunohistochemistry with Human Prostate lysate tissue at an antibody concentration of 5.0ug/ml using anti-SSX4 antibody)
Related Product Information for anti-SSX4 antibody
This is a rabbit polyclonal antibody against SSX4. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: SSX4 belongs to the SSX family. It contains 1 KRAB-related domain.SSX4 could act as a modulator of transcription. The product of this gene belongs to the family of highly homologous synovial sarcoma X (SSX) breakpoint proteins. These proteins may function as transcriptional repressors. They are also capable of eliciting spontaneously humoral and cellular immune responses in cancer patients, and are potentially useful targets in cancer vaccine-based immunotherapy. SSX1, SSX2 and SSX4 genes have been involved in the t(X;18) translocation characteristically found in all synovial sarcomas. This translocation results in the fusion of the synovial sarcoma translocation gene on chromosome 18 to one of the SSX genes on chromosome X. Chromosome Xp11 contains a segmental duplication resulting in two identical copies of synovial sarcoma, X breakpoint 4, SSX4 and SSX4B, in tail-to-tail orientation. This gene, SSX4, represents the more telomeric copy. Two transcript variants encoding distinct isoforms have been identified for this gene.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
22kDa
NCBI Official Full Name
protein SSX4 isoform a
NCBI Official Synonym Full Names
SSX family member 4
NCBI Official Symbol
SSX4
NCBI Official Synonym Symbols
CT5.4
NCBI Protein Information
protein SSX4
UniProt Protein Name
Protein SSX4
UniProt Gene Name
SSX4
UniProt Synonym Gene Names
SSX4A; CT5.4

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The SSX4 ssx4 (Catalog #AAA23446) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The SSX4 antibody - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's SSX4 can be used in a range of immunoassay formats including, but not limited to, IHC (Immunohistochemistry), WB (Western Blot). Researchers should empirically determine the suitability of the SSX4 ssx4 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: FPKIMPKKPA EEENGLKEVP EASGPQNDGK QLCPPGNPST LEKINKTSGP. It is sometimes possible for the material contained within the vial of "SSX4, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.