Rabbit ST6GAL1 Polyclonal Antibody | anti-ST6GAL1 antibody
ST6GAL1 antibody - C-terminal region
Gene Names
ST6GAL1; ST6N; SIAT1; ST6GalI
Reactivity
Tested Reactivity: Human, RatPredicted Reactivity: Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Sheep, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
ST6GAL1, Antibody; ST6GAL1 antibody - C-terminal region; anti-ST6GAL1 antibody
Host
Rabbit
Reactivity
Tested Reactivity: Human, Rat
Predicted Reactivity: Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Sheep, Zebrafish
Predicted Reactivity: Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Sheep, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: PPSSGMLGIIIMMTLCDQVDIYEFLPSKRKTDVCYYYQKFFDSACTMGAY
Sequence Length
175
Applicable Applications for anti-ST6GAL1 antibody
WB (Western Blot)
Protein Size (#AA)
175 Amino Acids
Protein Interactions
UBC; ST6GAL1; CD22
Blocking Peptide
For anti-ST6GAL1 ( ) antibody is Catalog #
Predicted Homology
Cow: 100%; Dog: 100%; Goat: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 93%; Rat: 100%; Sheep: 100%; Zebrafish: 77%
Replacement Item
This antibody may replace item sc-115864 from Santa Cruz Biotechnology.
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Related Product Information for anti-ST6GAL1 antibody
This is a rabbit polyclonal antibody against ST6GAL1. It was validated on Western Blot
Target Description: This gene encodes a member of glycosyltransferase family 29. The encoded protein is a type II membrane protein that catalyzes the transfer of sialic acid from CMP-sialic acid to galactose-containing substrates. The protein, which is normally found in the Golgi but can be proteolytically processed to a soluble form, is involved in the generation of the cell-surface carbohydrate determinants and differentiation antigens HB-6, CD75, and CD76. This gene has been incorrectly referred to as CD75. Three transcript variants encoding two different isoforms have been described.
Target Description: This gene encodes a member of glycosyltransferase family 29. The encoded protein is a type II membrane protein that catalyzes the transfer of sialic acid from CMP-sialic acid to galactose-containing substrates. The protein, which is normally found in the Golgi but can be proteolytically processed to a soluble form, is involved in the generation of the cell-surface carbohydrate determinants and differentiation antigens HB-6, CD75, and CD76. This gene has been incorrectly referred to as CD75. Three transcript variants encoding two different isoforms have been described.
Product Categories/Family for anti-ST6GAL1 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
21kDa
NCBI Official Full Name
beta-galactoside alpha-2,6-sialyltransferase 1 isoform b
NCBI Official Synonym Full Names
ST6 beta-galactoside alpha-2,6-sialyltransferase 1
NCBI Official Symbol
ST6GAL1
NCBI Official Synonym Symbols
ST6N; SIAT1; ST6GalI
NCBI Protein Information
beta-galactoside alpha-2,6-sialyltransferase 1
Customer Reviews
Loading reviews...
Share Your Experience
Similar Products
Product Notes
The ST6GAL1 (Catalog #AAA201260) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ST6GAL1 antibody - C-terminal region reacts with Tested Reactivity: Human, Rat Predicted Reactivity: Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Sheep, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's ST6GAL1 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the ST6GAL1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: PPSSGMLGII IMMTLCDQVD IYEFLPSKRK TDVCYYYQKF FDSACTMGAY. It is sometimes possible for the material contained within the vial of "ST6GAL1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
