Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA201491_WB11.jpg WB (Western Blot) (WB Suggested Anti-STAMBPL1 antibody Titration: 1 ug/mLSample Type: Human MDA-MB-435s)

Rabbit STAMBPL1 Polyclonal Antibody | anti-STAMBPL1 antibody

STAMBPL1 Antibody - C-terminal region

Average rating 0.0
No ratings yet
Gene Names
STAMBPL1; AMSH-FP; AMSH-LP; ALMalpha; bA399O19.2
Reactivity
Guinea Pig, Horse, Human, Pig, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
STAMBPL1, Antibody; STAMBPL1 Antibody - C-terminal region; anti-STAMBPL1 antibody
Ordering
Host
Rabbit
Reactivity
Guinea Pig, Horse, Human, Pig, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: VFADQPNKSDATNYASHSPPVNRALTPAATLSAVQNLVVEGLRCVVLPED
Sequence Length
436
Applicable Applications for anti-STAMBPL1 antibody
WB (Western Blot)
Homology
Guinea Pig: 79%; Horse: 93%; Human: 100%; Pig: 93%; Rabbit: 86%; Rat: 93%
Immunogen
The immunogen is a synthetic peptide directed towards the C-terminal region of Human STAMBPL1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-STAMBPL1 antibody Titration: 1 ug/mLSample Type: Human MDA-MB-435s)

product-image-AAA201491_WB11.jpg WB (Western Blot) (WB Suggested Anti-STAMBPL1 antibody Titration: 1 ug/mLSample Type: Human MDA-MB-435s)

WB (Western Blot)

(WB Suggested Anti-STAMBPL1 antibody Titration: 1 ug/mLSample Type: Human K562)

product-image-AAA201491_WB13.jpg WB (Western Blot) (WB Suggested Anti-STAMBPL1 antibody Titration: 1 ug/mLSample Type: Human K562)

WB (Western Blot)

(Host: RabbitTarget Name: STAMBPL1Sample Tissue: Human 786-0 Whole CellAntibody Dilution: 1ug/ml)

product-image-AAA201491_WB15.jpg WB (Western Blot) (Host: RabbitTarget Name: STAMBPL1Sample Tissue: Human 786-0 Whole CellAntibody Dilution: 1ug/ml)
Related Product Information for anti-STAMBPL1 antibody
This is a rabbit polyclonal antibody against STAMBPL1. It was validated on Western Blot

Target Description: STAMBPL1 is a zinc metalloprotease that specifically cleaves 'Lys-63'- linked polyubiquitin chains. It does not cleave 'Lys-48'-linked polyubiquitin chains. .
Product Categories/Family for anti-STAMBPL1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
47kDa
NCBI Official Full Name
AMSH-like protease
NCBI Official Synonym Full Names
STAM binding protein like 1
NCBI Official Symbol
STAMBPL1
NCBI Official Synonym Symbols
AMSH-FP; AMSH-LP; ALMalpha; bA399O19.2
NCBI Protein Information
AMSH-like protease
UniProt Protein Name
AMSH-like protease
UniProt Gene Name
STAMBPL1
UniProt Synonym Gene Names
AMSHLP; KIAA1373; AMSH-LP
UniProt Entry Name
STALP_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The STAMBPL1 stambpl1 (Catalog #AAA201491) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The STAMBPL1 Antibody - C-terminal region reacts with Guinea Pig, Horse, Human, Pig, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's STAMBPL1 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the STAMBPL1 stambpl1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: VFADQPNKSD ATNYASHSPP VNRALTPAAT LSAVQNLVVE GLRCVVLPED. It is sometimes possible for the material contained within the vial of "STAMBPL1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.