Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA197577_WB8.jpg WB (Western Blot) (WB Suggested Anti-STAT4 Antibody Titration: 1.25ug/mlELISA Titer: 1:62500Positive Control: Jurkat cell lysateSTAT4 is supported by BioGPS gene expression data to be expressed in Jurkat)

Rabbit STAT4 Polyclonal Antibody | anti-STAT4 antibody

STAT4 antibody - N-terminal region

Average rating 0.0
No ratings yet
Gene Names
STAT4; SLEB11
Reactivity
Dog, Horse, Human, Mouse, Pig, Rabbit, Rat
Applications
Western Blot, Immunohistochemistry
Purity
Protein A purified
Synonyms
STAT4, Antibody; STAT4 antibody - N-terminal region; anti-STAT4 antibody
Ordering
Host
Rabbit
Reactivity
Dog, Horse, Human, Mouse, Pig, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Protein A purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: IGGPLHNGLDQLQNCFTLLAESLFQLRRQLEKLEEQSTKMTYEGDPIPMQ
Sequence Length
748
Applicable Applications for anti-STAT4 antibody
WB (Western Blot), IHC (Immunohistochemistry)
Homology
Dog: 100%; Horse: 100%; Human: 100%; Mouse: 92%; Pig: 100%; Rabbit: 100%; Rat: 92%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human STAT4
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-STAT4 Antibody Titration: 1.25ug/mlELISA Titer: 1:62500Positive Control: Jurkat cell lysateSTAT4 is supported by BioGPS gene expression data to be expressed in Jurkat)

product-image-AAA197577_WB8.jpg WB (Western Blot) (WB Suggested Anti-STAT4 Antibody Titration: 1.25ug/mlELISA Titer: 1:62500Positive Control: Jurkat cell lysateSTAT4 is supported by BioGPS gene expression data to be expressed in Jurkat)

WB (Western Blot)

(Host: RabbitTarget Name: STAT4Sample Tissue: Mouse SpleenAntibody Dilution: 1ug/ml)

product-image-AAA197577_WB10.jpg WB (Western Blot) (Host: RabbitTarget Name: STAT4Sample Tissue: Mouse SpleenAntibody Dilution: 1ug/ml)

WB (Western Blot)

(Host: MouseTarget Name: STAT4Sample Tissue: Mouse SpleenAntibody Dilution: 1ug/ml)

product-image-AAA197577_WB11.jpg WB (Western Blot) (Host: MouseTarget Name: STAT4Sample Tissue: Mouse SpleenAntibody Dilution: 1ug/ml)

IHC (Immunohiostchemistry)

(Rabbit Anti-STAT4 antibodyParaffin Embedded Tissue: Human Heart cell Cellular Data: cardiac cell of renal tubuleAntibody Concentration: 4.0-8.0 ug/mlMagnification: 400X)

product-image-AAA197577_IHC13.jpg IHC (Immunohiostchemistry) (Rabbit Anti-STAT4 antibodyParaffin Embedded Tissue: Human Heart cell Cellular Data: cardiac cell of renal tubuleAntibody Concentration: 4.0-8.0 ug/mlMagnification: 400X)

IHC (Immunohistochemistry)

(Human Muscle)

product-image-AAA197577_IHC15.jpg IHC (Immunohistochemistry) (Human Muscle)
Related Product Information for anti-STAT4 antibody
This is a rabbit polyclonal antibody against STAT4. It was validated on Western Blot and immunohistochemistry

Target Description: STAT4 is a member of the STAT family of transcription factors. In response to cytokines and growth factors, STAT family members are phosphorylated by the receptor associated kinases, and then form homo- or heterodimers that translocate to the cell nucleus where they act as transcription activators. This protein is essential for mediating responses to IL12 in lymphocytes, and regulating the differentiation of T helper cells.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
86kDa
NCBI Official Full Name
signal transducer and activator of transcription 4
NCBI Official Synonym Full Names
signal transducer and activator of transcription 4
NCBI Official Symbol
STAT4
NCBI Official Synonym Symbols
SLEB11
NCBI Protein Information
signal transducer and activator of transcription 4
UniProt Protein Name
Signal transducer and activator of transcription 4
UniProt Gene Name
STAT4
UniProt Entry Name
STAT4_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The STAT4 stat4 (Catalog #AAA197577) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The STAT4 antibody - N-terminal region reacts with Dog, Horse, Human, Mouse, Pig, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's STAT4 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot), IHC (Immunohistochemistry). Researchers should empirically determine the suitability of the STAT4 stat4 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: IGGPLHNGLD QLQNCFTLLA ESLFQLRRQL EKLEEQSTKM TYEGDPIPMQ. It is sometimes possible for the material contained within the vial of "STAT4, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.