Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA281851_IF11.jpg IF (Immunofluorescence) (Immunofluorescence analysis of L929 cells using STEAP4 antibody at dilution of 1:100. Blue: DAPI for nuclear staining.)

Rabbit STEAP4 Polyclonal Antibody | anti-STEAP4 antibody

STEAP4 Rabbit pAb

Average rating 0.0
No ratings yet
Gene Names
STEAP4; TIARP; STAMP2; TNFAIP9
Reactivity
Human, Mouse, Rat
Applications
Immunofluorescence, Western Blot
Purity
Affinity purification
Synonyms
STEAP4, Antibody; STEAP4 Rabbit pAb; STAMP2; SchLAH; TIARP; TNFAIP9; STEAP4; anti-STEAP4 antibody
Ordering
Host
Rabbit
Reactivity
Human, Mouse, Rat
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity purification
Form/Format
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Sequence
MEKTCIDALPLTMNSSEKQETVCIFGTGDFGRSLGLKMLQCGYSVVFGSRNPQKTTLLPSGAEVLSYSEAAKKSGIIIIAIHREHYDFLTELTEVLNGKI
Applicable Applications for anti-STEAP4 antibody
IF (Immunofluorescence), WB (Western Blot)
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 1-100 of human STEAP4 (NP_001192245).
Positive Samples
Rat liver, Rat lung
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.

IF (Immunofluorescence)

(Immunofluorescence analysis of L929 cells using STEAP4 antibody at dilution of 1:100. Blue: DAPI for nuclear staining.)

product-image-AAA281851_IF11.jpg IF (Immunofluorescence) (Immunofluorescence analysis of L929 cells using STEAP4 antibody at dilution of 1:100. Blue: DAPI for nuclear staining.)

IF (Immunofluorescence)

(Immunofluorescence analysis of HeLa cells using STEAP4 antibody at dilution of 1:100. Blue: DAPI for nuclear staining.)

product-image-AAA281851_IF13.jpg IF (Immunofluorescence) (Immunofluorescence analysis of HeLa cells using STEAP4 antibody at dilution of 1:100. Blue: DAPI for nuclear staining.)

WB (Western Blot)

(Western blot analysis of extracts of various cell lines, using STEAP4 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 30s.)

product-image-AAA281851_WB15.jpg WB (Western Blot) (Western blot analysis of extracts of various cell lines, using STEAP4 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 30s.)
Related Product Information for anti-STEAP4 antibody
Background: The protein encoded by this gene belongs to the STEAP (six transmembrane epithelial antigen of prostate) family, and resides in the golgi apparatus. It functions as a metalloreductase that has the ability to reduce both Fe(3+) to Fe(2+) and Cu(2+) to Cu(1+), using NAD(+) as acceptor. Studies in mice and human suggest that this gene maybe involved in adipocyte development and metabolism, and may contribute to the normal biology of the prostate cell, as well as prostate cancer progression. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Apr 2011]

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
51,981 Da
NCBI Official Full Name
metalloreductase STEAP4 isoform 1
NCBI Official Synonym Full Names
STEAP family member 4
NCBI Official Symbol
STEAP4
NCBI Official Synonym Symbols
TIARP; STAMP2; TNFAIP9
NCBI Protein Information
metalloreductase STEAP4; six transmembrane prostate protein 2; sixTransMembrane protein of prostate 2; tumor necrosis factor, alpha-induced protein 9; six-transmembrane epithelial antigen of prostate 4; tumor necrosis-alpha-induced adipose-related protein
UniProt Protein Name
Metalloreductase STEAP4
UniProt Gene Name
STEAP4
UniProt Synonym Gene Names
STAMP2; TNFAIP9
UniProt Entry Name
STEA4_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The STEAP4 steap4 (Catalog #AAA281851) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The STEAP4 Rabbit pAb reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's STEAP4 can be used in a range of immunoassay formats including, but not limited to, IF (Immunofluorescence), WB (Western Blot). Researchers should empirically determine the suitability of the STEAP4 steap4 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MEKTCIDALP LTMNSSEKQE TVCIFGTGDF GRSLGLKMLQ CGYSVVFGSR NPQKTTLLPS GAEVLSYSEA AKKSGIIIIA IHREHYDFLT ELTEVLNGKI. It is sometimes possible for the material contained within the vial of "STEAP4, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.