Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA281843_IF8.jpg IF (Immunofluorescence) (Immunofluorescence analysis of U-2 OS cells using STIM2 antibody at dilution of 1:100. Blue: DAPI for nuclear staining.)

Rabbit STIM2 Polyclonal Antibody | anti-STIM2 antibody

STIM2 Rabbit pAb

Average rating 0.0
No ratings yet
Reactivity
Human, Mouse, Rat
Applications
Immunofluorescence, Immunohistochemistry, Western Blot
Purity
Affinity purification
Synonyms
STIM2, Antibody; STIM2 Rabbit pAb; STIM2; anti-STIM2 antibody
Ordering
Host
Rabbit
Reactivity
Human, Mouse, Rat
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity purification
Form/Format
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Sequence
CFTEEDRFSLEALQTIHKQMDDDKDGGIEVEESDEFIREDMKYKDATNKHSHLHREDKHITIEDLWKRWKTSEVHNWTLEDTLQWLIEFVELPQYEKNFRDNNVKGTTLPRIAVHEPSFMI
Applicable Applications for anti-STIM2 antibody
IF (Immunofluorescence), IHC (Immunohistochemistry), WB (Western Blot)
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 60-180 of human STIM2 (NP_001162588).
Positive Samples
293T
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.

IF (Immunofluorescence)

(Immunofluorescence analysis of U-2 OS cells using STIM2 antibody at dilution of 1:100. Blue: DAPI for nuclear staining.)

product-image-AAA281843_IF8.jpg IF (Immunofluorescence) (Immunofluorescence analysis of U-2 OS cells using STIM2 antibody at dilution of 1:100. Blue: DAPI for nuclear staining.)

IF (Immunofluorescence)

(Immunofluorescence analysis of L929 cells using STIM2 antibody at dilution of 1:100. Blue: DAPI for nuclear staining.)

product-image-AAA281843_IF10.jpg IF (Immunofluorescence) (Immunofluorescence analysis of L929 cells using STIM2 antibody at dilution of 1:100. Blue: DAPI for nuclear staining.)

IHC (Immunohistochemisry)

(Immunohistochemistry of paraffin-embedded Mouse brain using STIM2 Rabbit pAb at dilution of 1:100 (40x lens).)

product-image-AAA281843_IHC11.jpg IHC (Immunohistochemisry) (Immunohistochemistry of paraffin-embedded Mouse brain using STIM2 Rabbit pAb at dilution of 1:100 (40x lens).)

IHC (Immunohiostchemistry)

(Immunohistochemistry of paraffin-embedded Rat brain using STIM2 Rabbit pAb at dilution of 1:100 (40x lens).)

product-image-AAA281843_IHC13.jpg IHC (Immunohiostchemistry) (Immunohistochemistry of paraffin-embedded Rat brain using STIM2 Rabbit pAb at dilution of 1:100 (40x lens).)

WB (Western Blot)

(Western blot analysis of extracts of 293T cells, using STIM2 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 30s.)

product-image-AAA281843_WB15.jpg WB (Western Blot) (Western blot analysis of extracts of 293T cells, using STIM2 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 30s.)
Related Product Information for anti-STIM2 antibody
Background: This gene is a member of the stromal interaction molecule (STIM) family and likely arose, along with related family member STIM1, from a common ancestral gene. The encoded protein functions to regulate calcium concentrations in the cytosol and endoplasmic reticulum, and is involved in the activation of plasma membrane Orai Ca(2+) entry channels. This gene initiates translation from a non-AUG (UUG) start site. A signal peptide is cleaved from the resulting protein. Multiple transcript variants result from alternative splicing. [provided by RefSeq, Dec 2009]
Product Categories/Family for anti-STIM2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
68,026 Da
NCBI Official Full Name
stromal interaction molecule 2
NCBI Official Synonym Full Names
stromal interaction molecule 2
NCBI Official Symbol
STIM2
NCBI Protein Information
stromal interaction molecule 2
UniProt Protein Name
Stromal interaction molecule 2
UniProt Gene Name
STIM2
UniProt Synonym Gene Names
KIAA1482
UniProt Entry Name
STIM2_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The STIM2 stim2 (Catalog #AAA281843) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The STIM2 Rabbit pAb reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's STIM2 can be used in a range of immunoassay formats including, but not limited to, IF (Immunofluorescence), IHC (Immunohistochemistry), WB (Western Blot). Researchers should empirically determine the suitability of the STIM2 stim2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: CFTEEDRFSL EALQTIHKQM DDDKDGGIEV EESDEFIRED MKYKDATNKH SHLHREDKHI TIEDLWKRWK TSEVHNWTLE DTLQWLIEFV ELPQYEKNFR DNNVKGTTLP RIAVHEPSFM I. It is sometimes possible for the material contained within the vial of "STIM2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.