Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA200883_WB10.jpg WB (Western Blot) (WB Suggested Anti-STK11 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: HepG2 cell lysate)

Rabbit STK11 Polyclonal Antibody | anti-STK11 antibody

STK11 antibody - C-terminal region

Average rating 0.0
No ratings yet
Gene Names
STK11; PJS; LKB1; hLKB1
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rat, Zebrafish
Applications
Immunohistochemistry, Western Blot
Purity
Affinity Purified
Synonyms
STK11, Antibody; STK11 antibody - C-terminal region; anti-STK11 antibody
Ordering
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: EAPVPIPPSPDTKDRWRSMTVVPYLEDLHGADEDEDLFDIEDDIIYTQDF
Sequence Length
433
Applicable Applications for anti-STK11 antibody
IHC (Immunohistochemistry), WB (Western Blot)
Homology
Cow: 79%; Dog: 79%; Guinea Pig: 93%; Horse: 79%; Human: 100%; Mouse: 100%; Rat: 100%; Zebrafish: 79%
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human STK11
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-STK11 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: HepG2 cell lysate)

product-image-AAA200883_WB10.jpg WB (Western Blot) (WB Suggested Anti-STK11 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: HepG2 cell lysate)

WB (Western Blot)

(Host: RabbitTarget Name: STK11Sample Tissue: Mouse Small IntestineAntibody Dilution: 1ug/ml)

product-image-AAA200883_WB11.jpg WB (Western Blot) (Host: RabbitTarget Name: STK11Sample Tissue: Mouse Small IntestineAntibody Dilution: 1ug/ml)

WB (Western Blot)

(Host: MouseTarget Name: STK11Sample Tissue: Mouse Small IntestineAntibody Dilution: 1ug/ml)

product-image-AAA200883_WB13.jpg WB (Western Blot) (Host: MouseTarget Name: STK11Sample Tissue: Mouse Small IntestineAntibody Dilution: 1ug/ml)

IHC (Immunohistochemistry)

(Rabbit Anti-STK11 AntibodyFormalin Fixed Paraffin Embedded Tissue: Human heart TissueObserved Staining: CytoplasmicPrimary Antibody Concentration: N/AOther Working Concentrations: 1:600Secondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)

product-image-AAA200883_IHC15.jpg IHC (Immunohistochemistry) (Rabbit Anti-STK11 AntibodyFormalin Fixed Paraffin Embedded Tissue: Human heart TissueObserved Staining: CytoplasmicPrimary Antibody Concentration: N/AOther Working Concentrations: 1:600Secondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)
Related Product Information for anti-STK11 antibody
This is a rabbit polyclonal antibody against STK11. It was validated on Western Blot

Target Description: STK11is a member of the serine/threonine kinase family, regulates cell polarity and functions as a tumor suppressor. Mutations in its gene have been associated with Peutz-Jeghers syndrome, an autosomal dominant disorder characterized by the growth of polyps in the gastrointestinal tract, pigmented macules on the skin and mouth, and other neoplasms.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
49kDa
NCBI Official Full Name
serine/threonine-protein kinase STK11
NCBI Official Synonym Full Names
serine/threonine kinase 11
NCBI Official Symbol
STK11
NCBI Official Synonym Symbols
PJS; LKB1; hLKB1
NCBI Protein Information
serine/threonine-protein kinase STK11
UniProt Protein Name
Serine/threonine-protein kinase STK11
UniProt Gene Name
STK11
UniProt Synonym Gene Names
LKB1; PJS; LKB1; hLKB1
UniProt Entry Name
STK11_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The STK11 stk11 (Catalog #AAA200883) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The STK11 antibody - C-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's STK11 can be used in a range of immunoassay formats including, but not limited to, IHC (Immunohistochemistry), WB (Western Blot). Researchers should empirically determine the suitability of the STK11 stk11 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: EAPVPIPPSP DTKDRWRSMT VVPYLEDLHG ADEDEDLFDI EDDIIYTQDF. It is sometimes possible for the material contained within the vial of "STK11, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.