Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA281180_IHC13.jpg IHC (Immunohiostchemistry) (Immunohistochemistry of paraffin-embedded mouse brain using STMN1 Antibody at dilution of 1:200 (40x lens).)

Rabbit anti-Human, Mouse STMN1 Polyclonal Antibody | anti-STMN1 antibody

STMN1 Polyclonal Antibody

Gene Names
STMN1; Lag; SMN; OP18; PP17; PP19; PR22; LAP18; C1orf215
Reactivity
Human, Mouse
Applications
Immunofluorescence, Immunohistochemistry, Western Blot
Purity
Affinity Purification
Synonyms
STMN1, Antibody; STMN1 Polyclonal Antibody; C1orf215; Lag; LAP18; OP18; PP17; PP19; PR22; SMN; anti-STMN1 antibody
Ordering
Host
Rabbit
Reactivity
Human, Mouse
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity Purification
Sequence
MASSDIQVKELEKRASGQAFELILSPRSKESVPEFPLSPPKKKDLSLEEIQKKLEAAEERRKSHEAEVLKQLAEKREHEKEVLQKAIEENNNFSKMAEEKLTHKMEANKENREAQMAAKLERLREKDKHIEEVRKNKESKDPADETEAD
Sequence Length
174
Applicable Applications for anti-STMN1 antibody
IF (Immunofluorescence), IHC (Immunohistochemistry), WB (Western Blot)
Immunogen
Recombinant protein of human STMN1
Immunogen Species
Human
Storage Buffer
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Cellular Location
Cytoplasm, cytoskeleton
Preparation and Storage
Store at -20 degree C. Avoid freeze / thaw cycles.

IHC (Immunohiostchemistry)

(Immunohistochemistry of paraffin-embedded mouse brain using STMN1 Antibody at dilution of 1:200 (40x lens).)

product-image-AAA281180_IHC13.jpg IHC (Immunohiostchemistry) (Immunohistochemistry of paraffin-embedded mouse brain using STMN1 Antibody at dilution of 1:200 (40x lens).)

IHC (Immunohistochemistry)

(Immunohistochemistry of paraffin-embedded human kidney cancer using STMN1 Antibody at dilution of 1:200 (40x lens).)

product-image-AAA281180_IHC15.jpg IHC (Immunohistochemistry) (Immunohistochemistry of paraffin-embedded human kidney cancer using STMN1 Antibody at dilution of 1:200 (40x lens).)
Related Product Information for anti-STMN1 antibody
This gene belongs to the stathmin family of genes. It encodes a ubiquitous cytosolic phosphoprotein proposed to function as an intracellular relay integrating regulatory signals of the cellular environment. The encoded protein is involved in the regulation of the microtubule filament system by destabilizing microtubules. It prevents assembly and promotes disassembly of microtubules. Multiple transcript variants encoding different isoforms have been found for this gene.
Product Categories/Family for anti-STMN1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
17kDa/19kDa
NCBI Official Full Name
stathmin isoform b
NCBI Official Synonym Full Names
stathmin 1
NCBI Official Symbol
STMN1
NCBI Official Synonym Symbols
Lag; SMN; OP18; PP17; PP19; PR22; LAP18; C1orf215
NCBI Protein Information
stathmin
UniProt Protein Name
Stathmin
UniProt Gene Name
STMN1
UniProt Synonym Gene Names
C1orf215; LAP18; OP18; Op18; pp19

Similar Products

Product Notes

The STMN1 stmn1 (Catalog #AAA281180) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The STMN1 Polyclonal Antibody reacts with Human, Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's STMN1 can be used in a range of immunoassay formats including, but not limited to, IF (Immunofluorescence), IHC (Immunohistochemistry), WB (Western Blot). Researchers should empirically determine the suitability of the STMN1 stmn1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MASSDIQVKE LEKRASGQAF ELILSPRSKE SVPEFPLSPP KKKDLSLEEI QKKLEAAEER RKSHEAEVLK QLAEKREHEK EVLQKAIEEN NNFSKMAEEK LTHKMEANKE NREAQMAAKL ERLREKDKHI EEVRKNKESK DPADETEAD. It is sometimes possible for the material contained within the vial of "STMN1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.