Rabbit Stra8 Polyclonal Antibody | anti-STRA8 antibody
Stra8 Antibody - C-terminal region
Reactivity
Tested Reactivity: Mouse (Predicted Activity: Dog, Horse, Human, Mouse, Pig, Rat)
Applications
Western Blot
Purity
Affinity Purified
Synonyms
Stra8, Antibody; Stra8 Antibody - C-terminal region; anti-STRA8 antibody
Host
Rabbit
Reactivity
Tested Reactivity: Mouse (Predicted Activity: Dog, Horse, Human, Mouse, Pig, Rat)
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml (varies by lot)
Sequence
Synthetic peptide located within the following region: FLDKSEAQHMSNISAMFATCNSENPEEKFQLYIQIIEFFKSLGCVNTPLN
Sequence Length
393
Applicable Applications for anti-STRA8 antibody
WB (Western Blot)
Predicted Homology Based on Immunogen Sequence
Dog: 86%; Horse: 100%; Human: 100%; Mouse: 86%; Pig: 92%; Rat: 86%
Immunogen
The immunogen is a synthetic peptide directed towards the C-terminal region of Mouse Stra8
Protein Size(#AA)
393 amino acids
Replacement Item
This antibody may replace item sc-163393 from Santa Cruz Biotechnology.
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Related Product Information for anti-STRA8 antibody
This is a rabbit polyclonal antibody against Stra8. It was validated on Western Blot
Target Description: Stra8 is a meiosis-inducer required for the transition into meiosis for both female and male germ cells. In female germ cells, It is required for premeiotic DNA replication and subsequent events in meiotic prophase.
Target Description: Stra8 is a meiosis-inducer required for the transition into meiosis for both female and male germ cells. In female germ cells, It is required for premeiotic DNA replication and subsequent events in meiotic prophase.
Product Categories/Family for anti-STRA8 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
44kDa
NCBI Official Full Name
stimulated by retinoic acid gene 8 protein
NCBI Official Synonym Full Names
stimulated by retinoic acid gene 8
NCBI Official Symbol
Stra8
NCBI Protein Information
stimulated by retinoic acid gene 8 protein
UniProt Protein Name
Stimulated by retinoic acid gene 8 protein
UniProt Gene Name
Stra8
UniProt Entry Name
STRA8_MOUSE
Customer Reviews
Loading reviews...
Share Your Experience
Similar Products
Product Notes
The STRA8 stra8 (Catalog #AAA201249) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Stra8 Antibody - C-terminal region reacts with Tested Reactivity: Mouse (Predicted Activity: Dog, Horse, Human, Mouse, Pig, Rat) and may cross-react with other species as described in the data sheet. AAA Biotech's Stra8 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the STRA8 stra8 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: FLDKSEAQHM SNISAMFATC NSENPEEKFQ LYIQIIEFFK SLGCVNTPLN. It is sometimes possible for the material contained within the vial of "Stra8, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
