Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA199216_WB11.jpg WB (Western Blot) (WB Suggested Anti-STUB1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Human Spleen)

Rabbit STUB1 Polyclonal Antibody | anti-STUB1 antibody

STUB1 antibody - N-terminal region

Gene Names
STUB1; CHIP; SCA48; UBOX1; SCAR16; HSPABP2; NY-CO-7; SDCCAG7
Reactivity
Cow, Guinea Pig, Human, Mouse, Rat, Zebrafish
Applications
Western Blot, Immunohistochemistry
Purity
Affinity Purified
Synonyms
STUB1, Antibody; STUB1 antibody - N-terminal region; anti-STUB1 antibody
Ordering
Host
Rabbit
Reactivity
Cow, Guinea Pig, Human, Mouse, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: MKGKEEKEGGARLGAGGGSPEKSPSAQELKEQGNRLFVGRKYPEAAACYG
Sequence Length
303
Applicable Applications for anti-STUB1 antibody
WB (Western Blot), IHC (Immunohistochemistry)
Homology
Cow: 100%; Guinea Pig: 100%; Human: 100%; Mouse: 100%; Rat: 100%; Zebrafish: 93%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human STUB1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-STUB1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Human Spleen)

product-image-AAA199216_WB11.jpg WB (Western Blot) (WB Suggested Anti-STUB1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Human Spleen)

WB (Western Blot)

(Lanes:1:1ug insoluble STUB1 protein, 2:1ug soluble STUB1 protein, 3:1ug EPM2A protein, 4:1ug insoluble PPP1R3C protein, 5:1ug soluble PPP1R3C proteinPrimary Antibody Dilution:1:2500Secondary Antibody:Anti-rabbit-APSecondary Antibody Dilution:1:20,000Gene Name:STUB1Submitted by:Pedro Castanheira, Biocant)

product-image-AAA199216_WB13.jpg WB (Western Blot) (Lanes:1:1ug insoluble STUB1 protein, 2:1ug soluble STUB1 protein, 3:1ug EPM2A protein, 4:1ug insoluble PPP1R3C protein, 5:1ug soluble PPP1R3C proteinPrimary Antibody Dilution:1:2500Secondary Antibody:Anti-rabbit-APSecondary Antibody Dilution:1:20,000Gene Name:STUB1Submitted by:Pedro Castanheira, Biocant)

IHC (Immunohistochemistry)

product-image-AAA199216_IHC15.jpg IHC (Immunohistochemistry)
Related Product Information for anti-STUB1 antibody
This is a rabbit polyclonal antibody against STUB1. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: STUB1 modulates the activity of several chaperone complexes, including Hsp70, Hsc70 and Hsp90. It has E3 ubiquitin-protein ligase activity and targets misfolded chaperone substrates towards proteasomal degradation. STUB1 mediates transfer of non-canonical short ubiquitin chains to HSPA8 that have no effect on HSPA8 degradation.
Product Categories/Family for anti-STUB1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
35kDa
NCBI Official Full Name
E3 ubiquitin-protein ligase CHIP isoform a
NCBI Official Synonym Full Names
STIP1 homology and U-box containing protein 1
NCBI Official Symbol
STUB1
NCBI Official Synonym Symbols
CHIP; SCA48; UBOX1; SCAR16; HSPABP2; NY-CO-7; SDCCAG7
NCBI Protein Information
E3 ubiquitin-protein ligase CHIP
UniProt Protein Name
E3 ubiquitin-protein ligase CHIP
UniProt Gene Name
STUB1
UniProt Entry Name
CHIP_HUMAN

Similar Products

Product Notes

The STUB1 stub1 (Catalog #AAA199216) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The STUB1 antibody - N-terminal region reacts with Cow, Guinea Pig, Human, Mouse, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's STUB1 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot), IHC (Immunohistochemistry). Researchers should empirically determine the suitability of the STUB1 stub1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: MKGKEEKEGG ARLGAGGGSP EKSPSAQELK EQGNRLFVGR KYPEAAACYG. It is sometimes possible for the material contained within the vial of "STUB1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.