Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA199978_WB10.jpg WB (Western Blot) (WB Suggested Anti-SULT1A1 Antibody Titration: 0.2-1 ug/mlPositive Control: Human Liver)

Rabbit SULT1A1 Polyclonal Antibody | anti-SULT1A1 antibody

SULT1A1 antibody - N-terminal region

Average rating 0.0
No ratings yet
Gene Names
SULT1A1; PST; STP; STP1; P-PST; ST1A1; ST1A3; TSPST1; HAST1/HAST2
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish
Applications
Immunohistochemistry, Western Blot
Purity
Affinity Purified
Synonyms
SULT1A1, Antibody; SULT1A1 antibody - N-terminal region; anti-SULT1A1 antibody
Ordering
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: ELIQDTSRPPLEYVKGVPLIKYFAEALGPLQSFQARPDDLLISTYPKSGT
Sequence Length
295
Applicable Applications for anti-SULT1A1 antibody
IHC (Immunohistochemistry), WB (Western Blot)
Homology
Cow: 100%; Dog: 93%; Guinea Pig: 86%; Horse: 100%; Human: 100%; Mouse: 86%; Pig: 93%; Rabbit: 100%; Rat: 93%; Zebrafish: 86%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human SULT1A1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-SULT1A1 Antibody Titration: 0.2-1 ug/mlPositive Control: Human Liver)

product-image-AAA199978_WB10.jpg WB (Western Blot) (WB Suggested Anti-SULT1A1 Antibody Titration: 0.2-1 ug/mlPositive Control: Human Liver)

IHC (Immunohistochemisry)

(SULT1A1 antibody - N-terminal regionFormalin Fixed Paraffin Embedded Tissue: Human Lung TissueObserved Staining: Cytoplasm of pneumocytesPrimary Antibody Concentration: 1:100Other Working Concentrations: 1/600Secondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)

product-image-AAA199978_IHC11.jpg IHC (Immunohistochemisry) (SULT1A1 antibody - N-terminal regionFormalin Fixed Paraffin Embedded Tissue: Human Lung TissueObserved Staining: Cytoplasm of pneumocytesPrimary Antibody Concentration: 1:100Other Working Concentrations: 1/600Secondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)

IHC (Immunohiostchemistry)

(SULT1A1 antibody - N-terminal regionFormalin Fixed Paraffin Embedded Tissue: Human Liver TissueObserved Staining: Cytoplasm in hepatocytesPrimary Antibody Concentration: 1:100Other Working Concentrations: 1/600Secondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)

product-image-AAA199978_IHC13.jpg IHC (Immunohiostchemistry) (SULT1A1 antibody - N-terminal regionFormalin Fixed Paraffin Embedded Tissue: Human Liver TissueObserved Staining: Cytoplasm in hepatocytesPrimary Antibody Concentration: 1:100Other Working Concentrations: 1/600Secondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)

IHC (Immunohistochemistry)

(Rabbit Anti-SULT1A1 antibodyFormalin Fixed Paraffin Embedded Tissue: Human Adult Small intestineObserved Staining: Cytoplasm in hepatocytesPrimary Antibody Concentration: 1:600Secondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)

product-image-AAA199978_IHC15.jpg IHC (Immunohistochemistry) (Rabbit Anti-SULT1A1 antibodyFormalin Fixed Paraffin Embedded Tissue: Human Adult Small intestineObserved Staining: Cytoplasm in hepatocytesPrimary Antibody Concentration: 1:600Secondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)
Related Product Information for anti-SULT1A1 antibody
This is a rabbit polyclonal antibody against SULT1A1. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: Sulfotransferase enzymes catalyze the sulfate conjugation of many hormones, neurotransmitters, drugs, and xenobiotic compounds. These cytosolic enzymes are different in their tissue distributions and substrate specificities. The gene structure (number and length of exons) is similar among family members. SULT1A1 is one of two phenol sulfotransferases with thermostable enzyme activity. Sulfotransferase enzymes catalyze the sulfate conjugation of many hormones, neurotransmitters, drugs, and xenobiotic compounds. These cytosolic enzymes are different in their tissue distributions and substrate specificities. The gene structure (number and length of exons) is similar among family members. This gene encodes one of two phenol sulfotransferases with thermostable enzyme activity. Multiple alternatively spliced variants that encode two isoforms have been identified for this gene.
Product Categories/Family for anti-SULT1A1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
34kDa
NCBI Official Full Name
sulfotransferase 1A1 isoform a
NCBI Official Synonym Full Names
sulfotransferase family 1A member 1
NCBI Official Symbol
SULT1A1
NCBI Official Synonym Symbols
PST; STP; STP1; P-PST; ST1A1; ST1A3; TSPST1; HAST1/HAST2
NCBI Protein Information
sulfotransferase 1A1
UniProt Protein Name
Sulfotransferase 1A2
UniProt Gene Name
SULT1A2
UniProt Synonym Gene Names
STP2; ST1A2; P-PST 2
UniProt Entry Name
ST1A2_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The SULT1A1 sult1a2 (Catalog #AAA199978) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The SULT1A1 antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's SULT1A1 can be used in a range of immunoassay formats including, but not limited to, IHC (Immunohistochemistry), WB (Western Blot). Researchers should empirically determine the suitability of the SULT1A1 sult1a2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: ELIQDTSRPP LEYVKGVPLI KYFAEALGPL QSFQARPDDL LISTYPKSGT. It is sometimes possible for the material contained within the vial of "SULT1A1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.