Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA46256_IHC10.jpg IHC (Immunohistochemistry) (Anti- SULT2A1 Picoband antibody, AAA46256, IHC(P)IHC(P): Human Renal Cancer Tissue)

SULT2A1 Polyclonal Antibody | anti-SULT2A1 antibody

Anti-SULT2A1 Antibody

Gene Names
SULT2A1; HST; ST2; STD; hSTa; DHEAS; ST2A1; ST2A3; DHEA-ST
Reactivity
Human, Mouse, Rat
Applications
Immunohistochemistry, Western Blot
Purity
Immunogen Affinity Purified
Synonyms
SULT2A1, Antibody; Anti-SULT2A1 Antibody; Bile salt sulfotransferase; Alcohol/hydroxysteroid sulfotransferase; Bile salt sulfotranasferase 2A1; Dehydroepiandrosterone sulfotransferase; DHEA ST; DHEA sulfotranasferase; DHEA-ST; DHEAS; EC 2.8.2.14; Hst; hSTa; Hydroxysteroid sulfotransferase; ST2; ST2A1; ST2A1_HUMAN; ST2A3; STD; sulfotranasferase, dehydroepiandrosterone-preferring; Sulfotransferase 2A1; Sulfotransferase family 2A, dehydroepiandrosterone-preferring, member 1; Sulfotransferase family cytosolic 2A dehydroepiandrosterone (DHEA) preferring member 1; Sult2a1; sulfotransferase family 2A member 1; anti-SULT2A1 antibody
Ordering
Reactivity
Human, Mouse, Rat
Clonality
Polyclonal
Purity/Purification
Immunogen Affinity Purified
Form/Format
Lyophilized. Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Sequence Length
285
Applicable Applications for anti-SULT2A1 antibody
IHC (Immunohistochemistry), WB (Western Blot)
Immunogen
A synthetic peptide corresponding to a sequence at the C-terminus of human SULT2A1 (253-285aa DWKNHFTVAQAEDFDKLFQEKMADLPRELFPWE), different from the related mouse sequence by seven amino acids, and from the related rat sequence by eight amino acids.
Ig Type
Rabbit IgG
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Preparation and Storage
At -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquoted and stored frozen at -20 degree C for a longer time. Avoid repeated freezing and thawing.

IHC (Immunohistochemistry)

(Anti- SULT2A1 Picoband antibody, AAA46256, IHC(P)IHC(P): Human Renal Cancer Tissue)

product-image-AAA46256_IHC10.jpg IHC (Immunohistochemistry) (Anti- SULT2A1 Picoband antibody, AAA46256, IHC(P)IHC(P): Human Renal Cancer Tissue)

IHC (Immunohistochemisry)

(Anti- SULT2A1 Picoband antibody, AAA46256, IHC(P)IHC(P): Rat Liver Tissue)

product-image-AAA46256_IHC11.jpg IHC (Immunohistochemisry) (Anti- SULT2A1 Picoband antibody, AAA46256, IHC(P)IHC(P): Rat Liver Tissue)

IHC (Immunohiostchemistry)

(Anti- SULT2A1 Picoband antibody, AAA46256, IHC(P)IHC(P): Mouse Liver Tissue)

product-image-AAA46256_IHC13.jpg IHC (Immunohiostchemistry) (Anti- SULT2A1 Picoband antibody, AAA46256, IHC(P)IHC(P): Mouse Liver Tissue)

WB (Western Blot)

(Anti- SULT2A1 Picoband antibody, AAA46256, Western blottingAll lanes: Anti SULT2A1 (AAA46256) at 0.5ug/mlLane 1: Rat Liver Tissue Lysate at 50ugLane 2: Rat Kidney Tissue Lysate at 50ugLane 3: Mouse Liver Tissue Lysate at 50ugLane 4: Mouse Kidney Tissue Lysate at 50ugLane 5: HELA Whole Cell Lysate at 40ugLane 6: SW620 Whole Cell Lysate at 40ugPredicted bind size: 34KDObserved bind size: 34KD)

product-image-AAA46256_WB15.jpg WB (Western Blot) (Anti- SULT2A1 Picoband antibody, AAA46256, Western blottingAll lanes: Anti SULT2A1 (AAA46256) at 0.5ug/mlLane 1: Rat Liver Tissue Lysate at 50ugLane 2: Rat Kidney Tissue Lysate at 50ugLane 3: Mouse Liver Tissue Lysate at 50ugLane 4: Mouse Kidney Tissue Lysate at 50ugLane 5: HELA Whole Cell Lysate at 40ugLane 6: SW620 Whole Cell Lysate at 40ugPredicted bind size: 34KDObserved bind size: 34KD)
Related Product Information for anti-SULT2A1 antibody
Description: Rabbit IgG polyclonal antibody for Bile salt sulfotransferase(SULT2A1) detection. Tested with WB, IHC-P in Human;Mouse;Rat.

Background: Bile salt sulfotransferase, also known as hydroxysteroid sulfotransferase (HST) or sulfotransferase 2A1 (ST2A1), is an enzyme that in humans is encoded by the SULT2A1 gene. It is mapped to 19q13.3. This gene encodes a member of the sulfotransferase family. Sulfotransferases aid in the metabolism of drugs and endogenous compounds by converting these substances into more hydrophilic water-soluble sulfate conjugates that can be easily excreted. This protein catalyzes the sulfation of steroids and bile acids in the liver and adrenal glands, and may have a role in the inherited adrenal androgen excess in women with polycystic ovary syndrome.
References
1. "Entrez Gene: SULT2A1 sulfotransferase family, cytosolic, 2A, dehydroepiandrosterone (DHEA)-preferring, member 1". 2. Otterness DM, Wieben ED, Wood TC, Watson WG, Madden BJ, McCormick DJ, Weinshilboum RM (May 1992). "Human liver dehydroepiandrosterone sulfotransferase: molecular cloning and expression of cDNA". Mol. Pharmacol. 41(5): 865-72. 3. Otterness DM, Mohrenweiser HW, Brandriff BF, Weinshilboum RM (1995). "Dehydroepiandrosterone sulfotransferase gene (STD): localization to human chromosome band 19q13.3". Cytogenet. Cell Genet. 70 (1-2): 45-7.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
33,780 Da
NCBI Official Full Name
bile salt sulfotransferase
NCBI Official Synonym Full Names
sulfotransferase family 2A member 1
NCBI Official Symbol
SULT2A1
NCBI Official Synonym Symbols
HST; ST2; STD; hSTa; DHEAS; ST2A1; ST2A3; DHEA-ST
NCBI Protein Information
bile salt sulfotransferase
UniProt Protein Name
Bile salt sulfotransferase
UniProt Gene Name
SULT2A1
UniProt Synonym Gene Names
HST; STD; DHEA-ST; HST; ST2A1
UniProt Entry Name
ST2A1_HUMAN

Similar Products

Product Notes

The SULT2A1 sult2a1 (Catalog #AAA46256) is an Antibody and is intended for research purposes only. The product is available for immediate purchase. The Anti-SULT2A1 Antibody reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's SULT2A1 can be used in a range of immunoassay formats including, but not limited to, IHC (Immunohistochemistry), WB (Western Blot). Researchers should empirically determine the suitability of the SULT2A1 sult2a1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "SULT2A1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.